KEGG   Bacillus cereus B4264: BCB4264_A4754Help
Entry
BCB4264_A4754     CDS       T00805                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcb  Bacillus cereus B4264
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCB4264_A4754
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCB4264_A4754
   00620 Pyruvate metabolism
    BCB4264_A4754
   00640 Propanoate metabolism
    BCB4264_A4754
  Energy metabolism
   00680 Methane metabolism
    BCB4264_A4754
Enzymes [BR:bcb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BCB4264_A4754
Lipid biosynthesis proteins [BR:bcb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BCB4264_A4754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4606305..4607891)
Genome map
AA seq 528 aa AA seqDB search
MKREELLAPPSYNLVSEIEKYTGDKGKLALIWQDDKGNRREVTYAELMQGANKIGNAFIK
SGLQKGDKLLIMMPRLIEAYMTYIAAIKAGFVVIPSSEMLRKKDIEYRIGHGEVKAIVSY
EPYIRQFDDIEAMESLRKFVLSEQSVDGWINLKTALETESDMLEMAKTDKEDMVFLSYTS
GTTGNPKGVVHTHAWAYAHLRTSAPNWLGIEENDIVWATASPGWQKWIWSPFLATLGSGA
TGFVYHGKFEPKTYLNLLDDNKVNVLCCTPTEYRLMAKVEDLSQYNLEALHSAVSAGEPL
NREVIETFKKHFHITVRDGYGQTENTLLVGVMKGMDIRPGSMGKPTPGNHVDIVNEEGTP
VKVGEVGDIAVHIETPALFKQYYKDDERTAMQFRGDYYITGDKAKKDEDGYFWFEGRGDD
IIISSGYTIGPFEVEDALVKHPYVRECAVVASPDEIRGSVVKAFIVLRENIEKNEETLIP
TLQQHVKELTAPYKYPRKIEFVDELPKTISGKIRRIELRKQEMEIPSK
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgagaagaattgttggcgccaccgtcttataatttagtttctgaaatagagaaa
tatacaggtgataaagggaagttagctttaatttggcaagatgataaagggaatcgaagg
gaagttacatacgctgaattaatgcaaggtgcgaataaaattggaaacgcttttataaaa
agtggtttgcaaaaaggggacaagcttctcattatgatgccgcgtttaattgaagcgtac
atgacgtatattgctgctattaaagcagggtttgtcgtaattccaagctcggaaatgtta
cgtaaaaaagatatagaatatcgaattggacatggagaagtaaaagcgatagtaagctat
gagccgtatattaggcagtttgatgatatagaagcgatggaatctcttcgaaaatttgtc
ctgagcgagcagtcagtagatggatggattaatttaaaaacagcgttagaaacagagagt
gacatgttagaaatggcgaagacagataaagaagatatggtctttttatcttacacgtca
ggaacgacaggaaatccaaaaggtgtcgttcatacacatgcgtgggcatacgctcattta
cgtacgagcgctccaaattggctcggaattgaagagaatgatattgtatgggcaacagct
agtccaggctggcaaaagtggatttggagcccgtttttagcaactttaggatcaggggca
acagggtttgtatatcacggtaagtttgaaccgaaaacgtacctaaacttattagacgat
aataaggtgaatgtactttgttgtacaccgactgagtatagattaatggcaaaggtagaa
gatttaagccagtacaatttagaggcactacatagcgctgtatcggcaggtgagccgtta
aatagagaagtcattgaaacgttcaaaaagcactttcatattacagtgagagacggctat
gggcaaacggaaaatacattacttgttggtgtaatgaaagggatggatattagaccagga
tcaatggggaaaccaacgccaggtaaccacgtcgatatcgtaaatgaggaaggtactcca
gttaaagtaggcgaagttggtgatattgcggttcacattgaaacgccggccctctttaaa
caatattacaaagacgatgagcgtacagcgatgcaatttcgcggtgattattatattaca
ggtgataaagcgaagaaagatgaagacggctacttctggttcgaagggcgcggcgatgat
atcattattagctctggttatacaatcgggccgtttgaagtagaggatgcacttgtaaaa
catccttacgtaagagaatgtgcagttgtcgcaagtcctgatgaaattcgtggaagtgtc
gtgaaggcatttatcgtattaagagagaatatagaaaagaacgaagaaacattaattcca
acactccaacaacacgtcaaagaactcactgcaccatataaataccctcgcaaaattgaa
tttgtagatgaactaccaaaaacgatttctggaaaaattcgccgtattgaacttagaaaa
caagagatggagattccgtcaaaataa

DBGET integrated database retrieval system