KEGG   Bacillus cereus B4264: BCB4264_A4775Help
Entry
BCB4264_A4775     CDS       T00805                                 

Gene name
acsA
Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00010  Glycolysis / Gluconeogenesis
bcb00620  Pyruvate metabolism
bcb00640  Propanoate metabolism
bcb00680  Methane metabolism
bcb01100  Metabolic pathways
bcb01110  Biosynthesis of secondary metabolites
bcb01120  Microbial metabolism in diverse environments
bcb01130  Biosynthesis of antibiotics
bcb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCB4264_A4775 (acsA)
   00620 Pyruvate metabolism
    BCB4264_A4775 (acsA)
   00640 Propanoate metabolism
    BCB4264_A4775 (acsA)
  Energy metabolism
   00680 Methane metabolism
    BCB4264_A4775 (acsA)
Enzymes [BR:bcb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BCB4264_A4775 (acsA)
Lipid biosynthesis proteins [BR:bcb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BCB4264_A4775 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C FPRL1_inhibitor
Motif
Other DBs
NCBI-ProteinID: ACK62104
UniProt: B7H722
Position
complement(4624630..4626348)
Genome map
AA seq 572 aa AA seqDB search
MKVETLPVIKGENNLPNYDEAYANFNWEEVNKNFTWNETGRVNMAYEAIDKHAKSDRKNK
VALYYQDGSRKEKYTFKEMKDFSNKAGNVLKNYGDVEKGDRVFIFMPRSPELYFALLGAV
KLGAIVGPLFEAFMEGAVRDRLEDSEAKVLITTPELLERVPLNDLPALKTVFLVGDNVEE
GGKTVAFNPLFEQASKELHIEWLGREDGLILHYTSGSTGKPKGVLHAQNAMVQHYQTAKW
VLDLKEDDVYWCTADPGWVTGTAYGIFAPWLVGASNVILGGRFSPEAWYEALQDYGVTVW
YSAPTAFRMLMGAGQDAIKKYDLSQVRHVLSVGEPLNPEVIRWGMNAFGLRIHDTWWMTE
TGGQVICNYPCMEIRPGSMGKPIPGVKAAIVDNEGNEVPPYTMGNLAIAKGWPSMMRGIW
NNQQKYESYFMPGDWYVSGDSAYMDEDGYFWFQGRIDDVIMTSGERVGPFEVESKLIEHA
AVAEAGVIGIPDPVRGEIIKAFIALRAGYEPSDELKEEIRQFVKKGLAAHAAPRQIEFRD
KLPKTRSGKIMRRVLKAWELNLPTGDLSTMED
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagaaacgcttcctgtcattaaaggagaaaataatttgccgaattatgatgag
gcatacgcgaattttaactgggaagaggttaataaaaactttacttggaatgaaacaggc
cgagtaaatatggcgtatgaggcaattgataagcatgcgaaatccgatcgaaagaataaa
gtagctctttattatcaagatggatcgcgaaaagagaaatatacatttaaggaaatgaag
gatttttctaataaagcaggaaacgtccttaagaattatggcgatgtagaaaaaggcgat
cgcgtttttatttttatgccacgttctccagagttatatttcgcacttttaggtgcagtg
aaattaggagcaattgttggaccgctatttgaagcatttatggaaggcgcagttcgcgat
cgcttagaagatagcgaagcaaaggtgttaattacaacgcctgaattgttagagcgcgta
ccattaaatgatttaccggctttaaaaacagttttccttgttggagataatgtagaagaa
ggcggtaaaacggtagcgttcaatccgttatttgaacaagcttcaaaagaattacatatt
gaatggttaggccgtgaagacggtttgattctacattacacgtctggctctactggtaag
ccaaaaggtgtgcttcatgcgcaaaacgcaatggttcagcactatcaaacggcgaagtgg
gtattagatttaaaagaagacgatgtatattggtgtactgctgacccgggctgggtaact
ggaacagcttacggtattttcgcaccgtggttagttggagcgtcaaatgttattttaggt
ggacgctttagtccagaagcttggtatgaagcactgcaagattacggtgtgacggtttgg
tacagcgcaccaacagcattccgtatgttaatgggagctggacaagacgcaattaaaaaa
tatgacttatcacaagttcgtcacgtattaagcgttggtgagccgttaaatccagaagta
attcgctggggtatgaatgcatttggacttcgtattcatgatacgtggtggatgacagaa
acaggtggacaagtaatttgtaactacccttgtatggaaatccgtccaggttcaatgggt
aaaccaattccaggtgtgaaagcagcgattgttgataatgaaggaaatgaagtgcctcct
tacacaatgggtaacttagcaattgcgaaaggttggccatctatgatgcgcgggatctgg
aataaccagcaaaaatatgaatcttatttcatgccgggagattggtacgtatcaggtgac
tctgcctatatggatgaagatggatacttctggttccaaggacgtatcgacgatgtaatt
atgacgtcaggtgagcgcgttggtccgtttgaagtagaaagtaaattaatcgagcatgct
gctgttgcagaagctggtgtaattggtattcctgatccggtgcgcggcgaaattattaaa
gcatttatcgcacttcgagcaggatacgaaccatctgatgaattaaaagaagaaattcgt
caatttgtaaagaaaggcctagcagctcatgcagcgccacgacaaattgaatttagagat
aaattaccgaaaacgagaagtggtaaaattatgcgccgcgtattaaaagcgtgggagctg
aatttaccaacaggtgacttatcaacgatggaagattaa

DBGET integrated database retrieval system