KEGG   Bacillus cereus B4264: BCB4264_A4869Help
Entry
BCB4264_A4869     CDS       T00805                                 

Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bcb  Bacillus cereus B4264
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BCB4264_A4869
Enzymes [BR:bcb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BCB4264_A4869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4713349..4714152)
Genome map
AA seq 267 aa AA seqDB search
MWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHIGYHVVMGDLPSHGTTSRNRGHIDS
FDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQETKREDVEGIILSSPCLGVVT
GPSAPLQFASKILNVVAPKLQFATNLTVEMSTRNHEVRDAMENDSLFLRKVSVRWYSELI
KSIEIAHKKIDDFPDVPLLLMQACEDKLVDKTRVRTWFDNVKISDKAFKEWPNCYHELLN
EYERDEILSYIQSFTEMHVNNIVKTNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtggaattatgaagcggaggaagcaaaggctgtcattgttattgtgcacggtgcaatg
gaatatcacggacgttacgaagccgttgcggaaatgtggaatcatatcggctaccacgtc
gtgatgggggatcttccgtcacatggaacgacttcaagaaatagaggacatattgattca
tttgatgaatacatagaggaagttaaactatgggtgaaagaagcaagaaagtataggtta
cctatttttctattcggtcatagtatgggtggtcttattgtcattcgtatgatgcaagaa
acgaagagagaagatgtagagggtattattttgagttcgccttgtttaggggtagtgact
ggaccctctgctccgcttcaatttgcttcaaaaatattaaatgttgtggctccaaaattg
caatttgcaacgaatcttacggtggaaatgtcaacacgtaaccacgaagtgagagatgca
atggagaatgattctttgttcttgcgcaaagtatcagtacgttggtatagtgaattgatt
aagtctatcgaaattgctcataaaaaaatagatgattttccggatgttccgctcttgcta
atgcaagcttgtgaggataaacttgtagataaaacacgtgtccgcacttggtttgataat
gttaaaataagtgataaggcttttaaagaatggccgaattgttatcacgagttattaaat
gagtatgagcgtgatgaaattttgagttatattcagtcatttactgaaatgcatgtcaat
aatatagtaaaaacaaacaaataa

DBGET integrated database retrieval system