KEGG   Bacillus cereus B4264: BCB4264_A4869Help
Entry
BCB4264_A4869     CDS       T00805                                 

Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bcb  Bacillus cereus B4264
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bcb00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4713349..4714152)
Genome map
AA seq 267 aa AA seqDB search
MWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHIGYHVVMGDLPSHGTTSRNRGHIDS
FDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQETKREDVEGIILSSPCLGVVT
GPSAPLQFASKILNVVAPKLQFATNLTVEMSTRNHEVRDAMENDSLFLRKVSVRWYSELI
KSIEIAHKKIDDFPDVPLLLMQACEDKLVDKTRVRTWFDNVKISDKAFKEWPNCYHELLN
EYERDEILSYIQSFTEMHVNNIVKTNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtggaattatgaagcggaggaagcaaaggctgtcattgttattgtgcacggtgcaatg
gaatatcacggacgttacgaagccgttgcggaaatgtggaatcatatcggctaccacgtc
gtgatgggggatcttccgtcacatggaacgacttcaagaaatagaggacatattgattca
tttgatgaatacatagaggaagttaaactatgggtgaaagaagcaagaaagtataggtta
cctatttttctattcggtcatagtatgggtggtcttattgtcattcgtatgatgcaagaa
acgaagagagaagatgtagagggtattattttgagttcgccttgtttaggggtagtgact
ggaccctctgctccgcttcaatttgcttcaaaaatattaaatgttgtggctccaaaattg
caatttgcaacgaatcttacggtggaaatgtcaacacgtaaccacgaagtgagagatgca
atggagaatgattctttgttcttgcgcaaagtatcagtacgttggtatagtgaattgatt
aagtctatcgaaattgctcataaaaaaatagatgattttccggatgttccgctcttgcta
atgcaagcttgtgaggataaacttgtagataaaacacgtgtccgcacttggtttgataat
gttaaaataagtgataaggcttttaaagaatggccgaattgttatcacgagttattaaat
gagtatgagcgtgatgaaattttgagttatattcagtcatttactgaaatgcatgtcaat
aatatagtaaaaacaaacaaataa

DBGET integrated database retrieval system