KEGG   Bacillus cereus B4264: BCB4264_A5050Help
Entry
BCB4264_A5050     CDS       T00805                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bcb  Bacillus cereus B4264
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BCB4264_A5050 (gtaB)
   00052 Galactose metabolism
    BCB4264_A5050 (gtaB)
   00500 Starch and sucrose metabolism
    BCB4264_A5050 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BCB4264_A5050 (gtaB)
Enzymes [BR:bcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BCB4264_A5050 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4861530..4862420)
Genome map
AA seq 296 aa AA seqDB search
MMKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGK
TKRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARK
FIGDEPFAVLLGDDIVQAEKPCLRQLMDEYEKTLSSVIGVQTVPESETHRYGIIDPLEQE
GRRYQVRNFVEKPAQGTAPSNLAIMGRYILTPEIFMFLEQQHVGAGGEIQLTDAIQSLNE
IQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVAMMKKILEEQANQES
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaaaaagtaagaaaagcgataatcccagcagctggattaggaacacgtttttta
ccagcaacgaaagcaatgccgaaagaaatgttaccgatagtagataaaccaacgatccaa
tacattgtagaagaagcagtgaaatcgggtatcgaagatattattatcgttactggtaaa
acaaagcgttctattgaagatcattttgataatgcatttgaactagaacaaaacttatta
gagaagaaaaaatatgagttgcttgaaaaagtacaagcttcttcaaaaatggtagatatt
cattatatccgtcaaaaagagccgaagggactaggacatgctgtttggtgtgcgcgtaaa
ttcattggtgatgagccgtttgcagtgttactaggtgatgatattgtccaagctgagaaa
ccgtgtttacgtcaattaatggatgagtatgaaaaaacactttcttctgttattggtgta
caaactgttccagagtcggaaacacatcgctatggaattatcgatccattagaacaagaa
ggtcgtcgttaccaagttcgcaatttcgttgagaaaccagcacaaggtacagctccttca
aacttagcaattatgggccgttacattttaacgcctgaaatctttatgttcttagaacag
caacatgtcggtgctggtggtgaaattcaattaacagatgcaatccaaagcttaaatgaa
atccaacgtgtatttgcttacgatttcgaaggaaagcgctacgacgtaggtgaaaagcta
ggattcgttcaaacgacaattgaaatggccctgcaacacccagaattacgtgatgacatg
gttgcaatgatgaagaaaattttagaagaacaagcgaatcaagagtcataa

DBGET integrated database retrieval system