KEGG   Bacillus cereus B4264: BCB4264_A5050Help
Entry
BCB4264_A5050     CDS       T00805                                 

Gene name
gtaB
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00040  Pentose and glucuronate interconversions
bcb00052  Galactose metabolism
bcb00500  Starch and sucrose metabolism
bcb00520  Amino sugar and nucleotide sugar metabolism
bcb01100  Metabolic pathways
bcb01130  Biosynthesis of antibiotics
Module
bcb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BCB4264_A5050 (gtaB)
   00052 Galactose metabolism
    BCB4264_A5050 (gtaB)
   00500 Starch and sucrose metabolism
    BCB4264_A5050 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BCB4264_A5050 (gtaB)
Enzymes [BR:bcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BCB4264_A5050 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACK63034
UniProt: B7HBF4
Position
complement(4861530..4862420)
Genome map
AA seq 296 aa AA seqDB search
MMKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGK
TKRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARK
FIGDEPFAVLLGDDIVQAEKPCLRQLMDEYEKTLSSVIGVQTVPESETHRYGIIDPLEQE
GRRYQVRNFVEKPAQGTAPSNLAIMGRYILTPEIFMFLEQQHVGAGGEIQLTDAIQSLNE
IQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVAMMKKILEEQANQES
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaaaaagtaagaaaagcgataatcccagcagctggattaggaacacgtttttta
ccagcaacgaaagcaatgccgaaagaaatgttaccgatagtagataaaccaacgatccaa
tacattgtagaagaagcagtgaaatcgggtatcgaagatattattatcgttactggtaaa
acaaagcgttctattgaagatcattttgataatgcatttgaactagaacaaaacttatta
gagaagaaaaaatatgagttgcttgaaaaagtacaagcttcttcaaaaatggtagatatt
cattatatccgtcaaaaagagccgaagggactaggacatgctgtttggtgtgcgcgtaaa
ttcattggtgatgagccgtttgcagtgttactaggtgatgatattgtccaagctgagaaa
ccgtgtttacgtcaattaatggatgagtatgaaaaaacactttcttctgttattggtgta
caaactgttccagagtcggaaacacatcgctatggaattatcgatccattagaacaagaa
ggtcgtcgttaccaagttcgcaatttcgttgagaaaccagcacaaggtacagctccttca
aacttagcaattatgggccgttacattttaacgcctgaaatctttatgttcttagaacag
caacatgtcggtgctggtggtgaaattcaattaacagatgcaatccaaagcttaaatgaa
atccaacgtgtatttgcttacgatttcgaaggaaagcgctacgacgtaggtgaaaagcta
ggattcgttcaaacgacaattgaaatggccctgcaacacccagaattacgtgatgacatg
gttgcaatgatgaagaaaattttagaagaacaagcgaatcaagagtcataa

DBGET integrated database retrieval system