KEGG   Bacillus cereus B4264: BCB4264_A5114Help
Entry
BCB4264_A5114     CDS       T00805                                 

Definition
(GenBank) putative phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00010  Glycolysis / Gluconeogenesis
bcb00260  Glycine, serine and threonine metabolism
bcb00680  Methane metabolism
bcb01100  Metabolic pathways
bcb01110  Biosynthesis of secondary metabolites
bcb01120  Microbial metabolism in diverse environments
bcb01130  Biosynthesis of antibiotics
bcb01200  Carbon metabolism
bcb01230  Biosynthesis of amino acids
Module
bcb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcb_M00002  Glycolysis, core module involving three-carbon compounds
bcb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCB4264_A5114
  Energy metabolism
   00680 Methane metabolism
    BCB4264_A5114
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCB4264_A5114
Enzymes [BR:bcb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCB4264_A5114
Membrane trafficking [BR:bcb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BCB4264_A5114
Exosome [BR:bcb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCB4264_A5114
  Exosomal proteins of melanoma cells
   BCB4264_A5114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACK59290
UniProt: B7HCZ4
Position
4923255..4923809
Genome map
AA seq 184 aa AA seqDB search
MKKIIVIRHCSAIGQKRDDELTTDGKDQANTLATFLLENHLQIDHIISSPFVRAIDSIRP
YALQANLSIQEDERLTERILSNIPMDDWMQKLESTFTNIDIAFSGGESTKQATDRALSLI
QDVLQLNHTTTLLVTHGNLLTLILKHFDHTIGFNEWRTLTNPDIYEITIDEQCIIKRLWE
ASSK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattattgtaatacgacattgttcagcaattgggcaaaaacgtgatgatgaa
ttaacgaccgatggaaaagaccaagctaacacccttgctacattcctcttagaaaatcat
ctacaaatcgatcatattatttcaagcccatttgtccgagctatcgattccattcggccc
tatgcgctccaagctaacttatctatccaagaagatgaacgattaactgaacgcatattg
agcaacattccaatggatgattggatgcaaaaactagaatctacttttacaaatatagat
attgccttttcaggcggagagtcaacaaaacaagcaacagaccgggccctatcgcttatt
caagacgttttacaattaaaccatacgacaacactacttgttacacatggcaatttactt
acactcattttaaagcattttgatcatacgattggctttaatgaatggagaactctaacg
aatcctgatatttacgaaattacaatcgacgaacaatgtatcataaaacgcttatgggaa
gcatcgtccaagtaa

DBGET integrated database retrieval system