KEGG   Bacillus cereus B4264: BCB4264_A5114Help
Entry
BCB4264_A5114     CDS       T00805                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcb  Bacillus cereus B4264
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCB4264_A5114
   01230 Biosynthesis of amino acids
    BCB4264_A5114
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCB4264_A5114
  Energy metabolism
   00680 Methane metabolism
    BCB4264_A5114
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCB4264_A5114
Enzymes [BR:bcb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCB4264_A5114
Exosome [BR:bcb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCB4264_A5114
  Exosomal proteins of melanoma cells
   BCB4264_A5114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4923255..4923809
Genome map
AA seq 184 aa AA seqDB search
MKKIIVIRHCSAIGQKRDDELTTDGKDQANTLATFLLENHLQIDHIISSPFVRAIDSIRP
YALQANLSIQEDERLTERILSNIPMDDWMQKLESTFTNIDIAFSGGESTKQATDRALSLI
QDVLQLNHTTTLLVTHGNLLTLILKHFDHTIGFNEWRTLTNPDIYEITIDEQCIIKRLWE
ASSK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattattgtaatacgacattgttcagcaattgggcaaaaacgtgatgatgaa
ttaacgaccgatggaaaagaccaagctaacacccttgctacattcctcttagaaaatcat
ctacaaatcgatcatattatttcaagcccatttgtccgagctatcgattccattcggccc
tatgcgctccaagctaacttatctatccaagaagatgaacgattaactgaacgcatattg
agcaacattccaatggatgattggatgcaaaaactagaatctacttttacaaatatagat
attgccttttcaggcggagagtcaacaaaacaagcaacagaccgggccctatcgcttatt
caagacgttttacaattaaaccatacgacaacactacttgttacacatggcaatttactt
acactcattttaaagcattttgatcatacgattggctttaatgaatggagaactctaacg
aatcctgatatttacgaaattacaatcgacgaacaatgtatcataaaacgcttatgggaa
gcatcgtccaagtaa

DBGET integrated database retrieval system