KEGG   Bacillus cereus B4264: BCB4264_A5251Help
Entry
BCB4264_A5251     CDS       T00805                                 

Gene name
tpi
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00010  Glycolysis / Gluconeogenesis
bcb00051  Fructose and mannose metabolism
bcb00562  Inositol phosphate metabolism
bcb01100  Metabolic pathways
bcb01110  Biosynthesis of secondary metabolites
bcb01120  Microbial metabolism in diverse environments
bcb01130  Biosynthesis of antibiotics
bcb01200  Carbon metabolism
bcb01230  Biosynthesis of amino acids
Module
bcb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcb_M00002  Glycolysis, core module involving three-carbon compounds
bcb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCB4264_A5251 (tpi)
   00051 Fructose and mannose metabolism
    BCB4264_A5251 (tpi)
   00562 Inositol phosphate metabolism
    BCB4264_A5251 (tpi)
Enzymes [BR:bcb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BCB4264_A5251 (tpi)
Exosome [BR:bcb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BCB4264_A5251 (tpi)
  Exosomal proteins of bladder cancer cells
   BCB4264_A5251 (tpi)
  Exosomal proteins of melanoma cells
   BCB4264_A5251 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACK63153
UniProt: B7HED4
Position
complement(5052261..5053016)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATEGTDLQ
VGAQNMHFEKNGAFTGEISPVALSDLKVGYVVLGHSERREMFAETDESVNKKTIAAFEHG
LTPIVCCGETLEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSS
ADANEVCAHIRKVVAEAVSPEAAEAVRIQYGGSVKPENIKEYMAQSDIDGALVGGASLEP
ASFLGLLGAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgcaggtaactggaaaatgaataaaactctatcagaagcagtt
agcttcgtagaggaagttaaaggtcaaatcccagcagcttcagctgttgatgcagtagtt
tgctctccagctctattcttagagcgccttgtagcagcaactgaaggaactgacttacaa
gtaggtgcacaaaacatgcacttcgaaaaaaatggtgcattcactggcgaaattagccca
gtagcacttagcgacttaaaagttggctatgtagtacttggccactctgagcgtcgtgaa
atgtttgctgaaacagatgagtcagtaaacaaaaagactatcgcagcatttgaacatggt
ttaacaccaatcgtatgttgtggtgagactttagaagagcgcgaaagcggaaaaacattt
gatttagtagcaggtcaagtgacaaaagcacttgcaggtttaacagaagagcaagttaaa
gcaactgttatcgcttatgagccaatctgggctatcggtacaggtaaatcttcttcttct
gcagatgcaaacgaagtatgtgcgcacatccgtaaagttgttgcagaagctgtttctcca
gaagctgcagaagctgttcgtatccaatacggcggtagcgtaaaaccagaaaacattaaa
gagtatatggcacaatctgacatcgacggcgctttagttggcggtgctagcttagagcca
gcttcgttcttaggtcttctgggggcggtaaaatga

DBGET integrated database retrieval system