KEGG   Bacillus cereus B4264: BCB4264_A5408Help
Entry
BCB4264_A5408     CDS       T00805                                 

Gene name
murA1
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bcb  Bacillus cereus B4264
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bcb00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bcb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5206058..5207362)
Genome map
AA seq 434 aa AA seqDB search
MEKIIVRGGKRLNGTVRVEGAKNAVLPIIAAALLASDGKNVLSEVPVLSDVYTINEVLRH
LNAEVVFENNQVTIDSSKELNIEAPFEYVRKMRASVQVMGPLLARNGRARIALPGGCAIG
SRPIDQHLKGFEAMGAKVQVGNGFVEAYVEGELKGAKIYLDFPSVGATENIMSAATLAKG
TTILENAAKEPEIVDLANFLNAMGAKVRGAGTGTIRIEGVDKLYGANHSIIPDRIEAGTF
MVAAAITGGDILIENAVPEHLRSITAKMEEMGVKIIEENEGVRVIGPDKLKAVDIKTMPH
PGFPTDMQSQMMALLLQADGTSMITETVFENRFMHVEEFRRMNADIKIEGRSVIMNGPNS
LQGAEVAATDLRAAAALILAGLVSEGYTRVTELKHLDRGYVNFHKKLAALGATIERVNEK
VEEVKEQEVSDLHA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaagatcatcgtccgtggcggaaagcggttaaacggcacagtgcgtgttgagggc
gcaaaaaatgctgtattacctataatcgctgcagccctattagcgagtgatggaaagaat
gtactatctgaagtaccagttttgtctgatgtatacacaattaatgaggtattacgtcat
ttaaatgctgaagtcgtatttgaaaataatcaagtaacaatcgattcttctaaagaacta
aacattgaagcaccatttgaatatgtacgtaaaatgcgtgcatctgttcaagtaatggga
ccattattagcacgtaacggtcgtgctcgtattgcacttcctggtggatgtgcaattggt
tcacgtccaattgaccaacatttaaaaggcttcgaagcaatgggagcaaaagtacaggtt
ggtaacggttttgttgaggcatatgttgagggagaactaaaaggagctaaaatctactta
gacttcccaagcgtaggcgcgacagaaaacattatgtctgcagctacattagcaaaaggg
acaacaattcttgaaaacgcagcgaaagaaccagaaatcgttgacttagctaacttctta
aatgcgatgggagcgaaagtacgcggagctggaactggaacgattcgtatcgaaggcgtt
gataaattatatggtgcaaaccactctattattcctgaccgtattgaagcgggaacattc
atggttgcagcagcaattactggtggagacatcttaattgaaaatgctgtacctgaacat
ttacgctcaattacagcgaaaatggaagaaatgggtgttaaaattattgaggaaaacgaa
ggtgtacgtgttatcggcccagataagttaaaagcggttgatattaaaactatgcctcac
ccaggtttcccaacagacatgcaatcacaaatgatggcattattactacaagctgatgga
acaagcatgattacagaaacggtattcgaaaaccgctttatgcacgttgaagaattccgt
cgtatgaatgctgatattaaaattgaaggtcgttctgttattatgaacggtccaaacagc
ttacaaggtgctgaagtagcagcaactgacttacgtgctgcagctgcattaatcttagct
ggtttagtatcagaaggttatactcgtgtaactgagttaaaacatcttgaccgtggctat
gtaaacttccataagaaattagctgcattaggtgcaactattgaacgtgtaaacgaaaaa
gtagaagaagtgaaagaacaagaagtttctgatcttcacgcttaa

DBGET integrated database retrieval system