KEGG   Buchnera aphidicola Cc (Cinara cedri): BCc_125Help
Entry
BCc_125           CDS       T00423                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bcc  Buchnera aphidicola Cc (Cinara cedri)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bcc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCc_125 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCc_125 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BCc_125 (thrC)
Enzymes [BR:bcc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BCc_125 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(141328..142620)
Genome map
AA seq 430 aa AA seqDB search
MKLYNLKDINEEVNFLNAIKYGLGKKQGLFFPKYLPKFTPETLKKLIQMDFITRSTHILS
HFISDEISFVDLKKQIKKAFSFTKPIIVHVKKNISCLELFHGPTLAFKDFGARFMAQMLS
YWKKENSIMTILTATSGDTGAAVAHAFYRMNNIRVVILYPKGRISTLQEKLFCTLGENIH
TIAIDGSFDDCQYLVKKSFNDKKLKKNIGLNSANSINISRLLAQICYYFEAFALIPTDFH
KNIVISIPCGNFGNLTAGLIAKSLGLPIKSFIAATNANDTVPRFLKNGKWKPNKTISTIS
NAMDISQPNNWPRVEELFKRKKWNLKTLKSYSVSDKETERAIKKLYKIGYLSEPHAAIAY
TILKKNIKKEDFGLFLGTAHPSKFQDTVEKILKISLKLPISLKSRVNLKNLSYHMKPDFL
KLKEFLLKKI
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatataatttaaaagatataaatgaagaagtaaattttttaaatgcaataaaa
tacggattaggaaaaaaacaaggattattttttccaaaatatttaccaaaatttacacct
gaaacattaaagaaattaattcaaatggattttattactagaagtactcatatactatca
cattttatctccgatgaaatatcatttgttgacttaaaaaaacaaataaaaaaagctttt
tcatttactaaacctataattgttcatgttaaaaaaaatatttcatgtttagaattattt
cacggaccaacattagcatttaaagattttggagctagatttatggctcaaatgctttca
tattggaaaaaagaaaattctattatgactatattaactgctacttctggagataccggt
gctgctgttgcgcatgcattttatcgtatgaataatattcgtgtagttattttatatcct
aaaggaagaattagtacattacaagaaaaactattttgtacattaggagaaaatatacat
accattgcaattgatggtagttttgatgattgtcaatatttggtaaaaaaatcttttaat
gataaaaaactaaaaaaaaatattggcttaaattcagctaattctattaatattagtaga
ttattagctcaaatatgttattattttgaagcatttgcattaataccaacagactttcat
aaaaatattgttatttcaattccatgtggtaattttggtaatttaacagctggattaata
gcaaaatctcttggattaccaataaaatcttttatcgcagctactaatgctaacgatact
gttccaagatttttaaaaaatggaaaatggaaaccaaataaaacaatatcaactatttct
aatgctatggatattagtcaacctaataattggccaagagttgaagaattatttaaaaga
aaaaaatggaatttaaaaacactaaaatcttatagtgtgtcagataaagaaacagagaga
gcgataaaaaaattatataaaattggatatttatcagaaccgcatgcagctatagcatat
acaatactaaagaaaaatattaaaaaagaagattttggtttatttttaggaacagcgcat
ccatctaaatttcaagatactgtagaaaaaatattaaaaatttcattaaaattaccaata
tccttaaaatccagagtaaatttaaaaaatttatcataccatatgaaacctgatttttta
aaattaaaagaatttttattaaaaaaaatttaa

DBGET integrated database retrieval system