KEGG   Buchnera aphidicola BCc: BCc_125Help
Entry
BCc_125           CDS       T00423                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bcc  Buchnera aphidicola BCc
Pathway
bcc00260  Glycine, serine and threonine metabolism
bcc00750  Vitamin B6 metabolism
bcc01100  Metabolic pathways
bcc01110  Biosynthesis of secondary metabolites
bcc01120  Microbial metabolism in diverse environments
bcc01230  Biosynthesis of amino acids
Module
bcc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bcc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCc_125 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BCc_125 (thrC)
Enzymes [BR:bcc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BCc_125 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ABJ90601
UniProt: Q057U8
Position
complement(141328..142620)
Genome map
AA seq 430 aa AA seqDB search
MKLYNLKDINEEVNFLNAIKYGLGKKQGLFFPKYLPKFTPETLKKLIQMDFITRSTHILS
HFISDEISFVDLKKQIKKAFSFTKPIIVHVKKNISCLELFHGPTLAFKDFGARFMAQMLS
YWKKENSIMTILTATSGDTGAAVAHAFYRMNNIRVVILYPKGRISTLQEKLFCTLGENIH
TIAIDGSFDDCQYLVKKSFNDKKLKKNIGLNSANSINISRLLAQICYYFEAFALIPTDFH
KNIVISIPCGNFGNLTAGLIAKSLGLPIKSFIAATNANDTVPRFLKNGKWKPNKTISTIS
NAMDISQPNNWPRVEELFKRKKWNLKTLKSYSVSDKETERAIKKLYKIGYLSEPHAAIAY
TILKKNIKKEDFGLFLGTAHPSKFQDTVEKILKISLKLPISLKSRVNLKNLSYHMKPDFL
KLKEFLLKKI
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatataatttaaaagatataaatgaagaagtaaattttttaaatgcaataaaa
tacggattaggaaaaaaacaaggattattttttccaaaatatttaccaaaatttacacct
gaaacattaaagaaattaattcaaatggattttattactagaagtactcatatactatca
cattttatctccgatgaaatatcatttgttgacttaaaaaaacaaataaaaaaagctttt
tcatttactaaacctataattgttcatgttaaaaaaaatatttcatgtttagaattattt
cacggaccaacattagcatttaaagattttggagctagatttatggctcaaatgctttca
tattggaaaaaagaaaattctattatgactatattaactgctacttctggagataccggt
gctgctgttgcgcatgcattttatcgtatgaataatattcgtgtagttattttatatcct
aaaggaagaattagtacattacaagaaaaactattttgtacattaggagaaaatatacat
accattgcaattgatggtagttttgatgattgtcaatatttggtaaaaaaatcttttaat
gataaaaaactaaaaaaaaatattggcttaaattcagctaattctattaatattagtaga
ttattagctcaaatatgttattattttgaagcatttgcattaataccaacagactttcat
aaaaatattgttatttcaattccatgtggtaattttggtaatttaacagctggattaata
gcaaaatctcttggattaccaataaaatcttttatcgcagctactaatgctaacgatact
gttccaagatttttaaaaaatggaaaatggaaaccaaataaaacaatatcaactatttct
aatgctatggatattagtcaacctaataattggccaagagttgaagaattatttaaaaga
aaaaaatggaatttaaaaacactaaaatcttatagtgtgtcagataaagaaacagagaga
gcgataaaaaaattatataaaattggatatttatcagaaccgcatgcagctatagcatat
acaatactaaagaaaaatattaaaaaagaagattttggtttatttttaggaacagcgcat
ccatctaaatttcaagatactgtagaaaaaatattaaaaatttcattaaaattaccaata
tccttaaaatccagagtaaatttaaaaaatttatcataccatatgaaacctgatttttta
aaattaaaagaatttttattaaaaaaaatttaa

DBGET integrated database retrieval system