KEGG   Buchnera aphidicola BCc: BCc_132Help
Entry
BCc_132           CDS       T00423                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcc  Buchnera aphidicola BCc
Pathway
bcc00010  Glycolysis / Gluconeogenesis
bcc00020  Citrate cycle (TCA cycle)
bcc00620  Pyruvate metabolism
bcc01100  Metabolic pathways
bcc01110  Biosynthesis of secondary metabolites
bcc01120  Microbial metabolism in diverse environments
bcc01130  Biosynthesis of antibiotics
bcc01200  Carbon metabolism
Module
bcc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCc_132 (aceF)
   00020 Citrate cycle (TCA cycle)
    BCc_132 (aceF)
   00620 Pyruvate metabolism
    BCc_132 (aceF)
Enzymes [BR:bcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BCc_132 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H RnfC_N DUF1999
Motif
Other DBs
NCBI-ProteinID: ABJ90608
UniProt: Q057U1
Position
155222..156475
Genome map
AA seq 417 aa AA seqDB search
MDVEVRVPDIGIKDVEVIEIFVKKGDIVSKEDSLISVEGHKSVLEIPSPISGIIKKICTQ
VGDKLSIDKLILIINNNQENNISKKNNKDYIQNSIDYLNHTNNNNKDIKYLNEKNNKNIH
ASPYIRRFARILDINLLYINGSGKKGRIVKKDIEKYDFLNKNINNNFIEKNNCLTELNTK
NIDNKSINQPLTRIQRISGKNLLNNWNNIPHVTQFDEADITELEDFRKSYNLNQLNKNKS
FQKVSLLSFLVKSVIHALLKYPRFNSILDKSKKNIIIKKDINIGIAVDTHDGLLVPVLKS
LKNKTIYEISNNIFNVVTKTKNNQLCTSEMTDGSFTISSLGGIGGIGFTPIINAPEVCIL
GISKADIKPVWNKKKFYPRLILPFSISYDHRVIDGADGVRFTTFLKDILSDIRILLM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtggacgtagaagttcgtgtaccagatattggaattaaagatgttgaagtaattgaaatt
ttcgtaaaaaaaggagatatagttagtaaagaagatagtttaatttctgttgaaggacat
aaatcagttcttgaaattccatctcctatttctggtataataaaaaaaatatgtacacaa
gtaggagataaattatctattgataaattaattttaataattaataataatcaagagaat
aatatttctaaaaaaaataataaagattatattcaaaatagtattgattatttaaatcat
acaaataataataataaagacataaaatatttaaacgaaaaaaataataaaaatattcat
gcatctccttatattcgtcgttttgcaagaattttagatattaatttgttatatataaat
ggaagtggaaaaaaaggaagaattgtaaaaaaagatatagaaaaatatgattttttaaat
aaaaatataaataataattttatagaaaagaataactgtttaacagaattgaatacaaag
aatatagataataaatctataaatcaaccattaactaggattcaaagaatttctggtaaa
aatttattaaataattggaataatattccacatgttactcaattcgatgaagcagatata
actgaattagaagattttagaaaatcatataatttaaatcaattaaataaaaataaatct
tttcaaaaggtttcgttattatcgtttttagttaaatctgtaatacatgctttattaaaa
tatcctagatttaatagtattttagataaaagtaaaaaaaatataattattaaaaaagat
attaatattggtatagctgttgatactcatgatggtttattagtaccagttttaaaaagt
ttaaaaaataaaactatttatgaaatatcaaataatatttttaatgtagttacaaaaact
aaaaataatcaattatgcacctcggaaatgactgatggtagttttactatttctagttta
ggaggaattggtggtattggatttacaccaattattaatgctccagaagtttgtatatta
ggtatctcaaaagcagatataaaacctgtttggaataaaaaaaaattttatcctcgttta
attcttcctttttctatatcatatgatcatcgtgtaatagatggtgctgacggcgttcgt
tttactacttttttaaaagatatattatctgatattaggatattgttaatgtag

DBGET integrated database retrieval system