KEGG   Buchnera aphidicola Cc (Cinara cedri): BCc_185Help
Entry
BCc_185           CDS       T00423                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bcc  Buchnera aphidicola Cc (Cinara cedri)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCc_185 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCc_185 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BCc_185 (sucB)
Enzymes [BR:bcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BCc_185 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
217701..218897
Genome map
AA seq 398 aa AA seqDB search
MEKKTKILAPNLPESVNHAIMLKWNKKIGDYVKEDEIIAEIETDKIILEISSPKNGILIS
QNILVGEKIKSQSVIGFINNKNIKKEKKIKNNKKTKKKNVHSENSLFLFTPKMRRLILNY
NIDISKIKGIDVHGKININNFIIKNKKNSKKKKKDKLINIHKKNNKRIFRKIAMSPLRKT
ISKRLLYTVKNTAMLTTFNEVNMQPIISIRNKYKDIFENKYKSKLGFMSFYVKSVTQALK
KFPEINASIEKKNIIYHDYYDINIAISTPRGLITPILKNTDNLSIYEIEKKIKSFVLLGE
QGKLKFEDLEAGTFTITNGGVFGSLMSTPIINPPQVAILGMHHIKKRPIVVNKKIKILPM
MYLALSYDHQLIDGKQAIQFLNYIKDILEDISRFILEI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaaactaaaatattagctcccaatttacctgaatcagtaaatcatgcaatt
atgttaaaatggaataaaaaaataggagattatgtaaaagaagatgaaataattgctgaa
attgaaactgataaaattatacttgaaatttcatctcctaaaaatggtatattaatttca
cagaatatattagttggagaaaaaataaaatctcaatctgttataggttttattaataat
aaaaatattaaaaaagaaaaaaaaattaaaaataataaaaaaacaaaaaaaaaaaatgtt
catagtgaaaattcattatttttgtttacaccaaaaatgcgtaggttaatactaaattat
aatatagatatatcaaaaataaaaggaattgatgtacatggaaaaattaatataaataat
tttattattaaaaataaaaaaaatagcaaaaagaaaaaaaaagataaactaattaatata
cataaaaaaaataataaacgaatttttcgaaaaattgctatgagtccgttacgaaaaacg
atttcaaaaagattattatatacagtaaaaaatacagctatgttaacaacatttaatgaa
gttaatatgcagccaattatatcaattagaaacaaatataaagatatttttgaaaataaa
tataaatcaaaattgggatttatgtcgttttatgtaaaatctgttacacaagcattaaaa
aaatttccagaaataaatgcttcaattgaaaaaaaaaatattatatatcatgattattat
gatattaatattgctatatctactccaagaggattaataactccaattttaaaaaataca
gataatttatctatatatgaaattgaaaaaaaaattaaatcttttgttttattaggtgaa
caaggaaaattaaaatttgaagatttagaagctggaacttttactattacaaatggagga
gtttttggatctttaatgtctactcctattattaatcctcctcaagtagctattttaggt
atgcatcatattaaaaaaagacctattgtagttaataaaaaaataaaaattttacctatg
atgtatcttgcattgtcatatgatcaccaattaattgatggaaaacaagcaatacaattt
ttgaattatattaaagatattttagaagatatttcacgttttatacttgaaatataa

DBGET integrated database retrieval system