KEGG   Buchnera aphidicola Cc (Cinara cedri): BCc_186Help
Entry
BCc_186           CDS       T00423                                 

Gene name
gpmA
Definition
hypothetical protein (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcc  Buchnera aphidicola Cc (Cinara cedri)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCc_186 (gpmA)
   01230 Biosynthesis of amino acids
    BCc_186 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCc_186 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BCc_186 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCc_186 (gpmA)
Enzymes [BR:bcc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCc_186 (gpmA)
Exosome [BR:bcc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCc_186 (gpmA)
  Exosomal proteins of melanoma cells
   BCc_186 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
219187..219879
Genome map
AA seq 230 aa AA seqDB search
MKKKKIILMRHGESKWNKLNKFTGWQDIGLTKNGKKEAKLAAKLIKKNNFIFDIAYTSIL
KRAIYTLWIILKKTNQIWIPVYKSWKLNERNYGALEGLNKEKIKKKYGDEQVQLWRRSFT
VCPPNLNISNKYHPIYDIKYKKLKKHELPTSESLEMTFNRVIPFWEFKILPQLEKNKNIL
IVAHGNSLRALIKYLGNISDSDIIDLDISTGKPLVYEFSNTNKPLKYYYL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaaaaaataatattaatgagacatggtgaaagtaaatggaataagttaaat
aaatttactggatggcaagatataggtttaactaaaaatggaaaaaaagaagcaaaactt
gctgcaaaattaataaaaaaaaataattttatatttgatattgcatatacatcaatttta
aaaagagctatatatactttatggataatacttaaaaaaacaaatcaaatatggatacca
gtatataaatcatggaaattaaacgaacgaaattatggagcattagaaggattaaataaa
gaaaaaataaaaaaaaaatatggagatgaacaagtacaattatggaggagaagttttaca
gtatgtccaccaaatttaaatatatctaataaatatcatcctatttatgacataaaatat
aaaaaattaaaaaaacatgaacttcctacatctgaaagtttagaaatgacatttaataga
gttattccattctgggaatttaaaattttacctcaattagagaaaaataaaaatattctt
attgttgctcacggaaattccttgcgagctttaataaaatatttgggaaacataagtgat
tccgatataattgatttagatatttctactggaaaaccgcttgtatatgaattttctaat
acaaataaaccattaaaatattattatttataa

DBGET integrated database retrieval system