KEGG   Buchnera aphidicola Cc (Cinara cedri): BCc_187Help
Entry
BCc_187           CDS       T00423                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bcc  Buchnera aphidicola Cc (Cinara cedri)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCc_187 (pfkA)
   01230 Biosynthesis of amino acids
    BCc_187 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCc_187 (pfkA)
   00030 Pentose phosphate pathway
    BCc_187 (pfkA)
   00051 Fructose and mannose metabolism
    BCc_187 (pfkA)
   00052 Galactose metabolism
    BCc_187 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BCc_187 (pfkA)
Enzymes [BR:bcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BCc_187 (pfkA)
Protein phosphatases and associated proteins [BR:bcc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BCc_187 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
220001..220963
Genome map
AA seq 320 aa AA seqDB search
MIKKIGILTSGGDSPGMNAIIRSVVCTALNHNIEVKGIYNGFLGLYNNDMKLLKYSHVAN
LLNQGGTILGSSRFLEFKLEKTRKIAIKNIYKRKIDCLIIIGGDGSYKAANFLTNMGVPC
IGIPGTIDNDVSGTDYTVGYFTALETVVDAIDKLRDTSASHHRISIIEIMGRYCGDLTLS
AAIAGGCEFIVIPEIIYQKELLLLEIQKSIKKGNKHSIVAITEHICDVNKLAKYIQKKTF
KETRATILGHIQRGGKPVAYDRILASRMGIYAIQLLLKGYKGQCIGVINNKIVHHNINYA
LKNMKKIFKKDLLNSIKKIY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaataggaattttaactagtggtggtgattctccaggaatgaatgctatt
attcgatctgttgtatgtactgctttaaatcataatatagaagttaaaggtatatataac
ggatttttaggattatataataatgatatgaaattattaaaatatagtcatgttgctaat
ttattaaatcaaggtggaacaattttaggatcttctcgatttttagaatttaaattagaa
aaaacaagaaaaatagctataaaaaacatttataaaagaaaaattgattgtttaatcatt
attggaggagatggatcttataaagcagcaaattttttaacaaatatgggtgttccatgt
attggtattcccggaactatagataatgatgtttctggaactgattatactgttggatat
tttactgctttagaaacagtagtagatgctattgataaattaagagatacttctgcatca
catcatagaatttcaataatagaaattatgggtcgttattgtggagatttaacattatca
gctgctattgccggtggttgtgaatttatagttattccagaaataatttatcaaaaagaa
ttattattactagaaatacaaaaaagtattaaaaaaggtaataaacattctattgtagct
attactgaacatatatgtgatgtaaataaattagcaaaatatattcaaaaaaaaactttt
aaagaaacaagagcaaccatattaggtcatattcaaagaggagggaaacctgttgcatat
gatagaattttagcatctcgtatgggtatttatgcaattcaattacttctaaaaggatat
aaaggacaatgtataggagtaattaataataaaatagttcatcataatatcaattatgct
ttaaaaaatatgaaaaaaatatttaaaaaagatttattaaattctataaaaaaaatatac
taa

DBGET integrated database retrieval system