KEGG   Buchnera aphidicola Cc (Cinara cedri): BCc_188Help
Entry
BCc_188           CDS       T00423                                 

Gene name
tpiA
Definition
hypothetical protein (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bcc  Buchnera aphidicola Cc (Cinara cedri)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCc_188 (tpiA)
   01230 Biosynthesis of amino acids
    BCc_188 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCc_188 (tpiA)
   00051 Fructose and mannose metabolism
    BCc_188 (tpiA)
   00562 Inositol phosphate metabolism
    BCc_188 (tpiA)
Enzymes [BR:bcc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BCc_188 (tpiA)
Exosome [BR:bcc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BCc_188 (tpiA)
  Exosomal proteins of bladder cancer cells
   BCc_188 (tpiA)
  Exosomal proteins of melanoma cells
   BCc_188 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(221127..221891)
Genome map
AA seq 254 aa AA seqDB search
MIKPIIVGNWKLNGSKKLIESFLKQLNQFLIKYYKICTVVIAPPVLYSHLIQNMFSSDKK
NFFLGAQNIDIHFSGPFTGEISPIMLKDIGIKYVIIGHSERRLNHKETNEIIAKKFCMLK
EENLVPILCIGETKKEKIDKKTKDICKKQIDIIFNMYGSNAFDNSIIAYEPIWSIGSGNS
AAPKEVQCIAHFIRNYVKSKSNHNIENFFIQYGGSVTKNNAKELIYQKDIDGFLVGGASL
QLEEFSKIIEITNI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaccaataattgtagggaattggaaattaaatggaagtaaaaaattaattgaa
agttttttaaaacaattaaatcaatttttaattaaatattacaaaatatgtactgttgtt
attgcgccgcctgttttatattctcatttaattcaaaatatgttttcttctgataaaaaa
aatttttttttaggcgcccaaaatattgatattcatttttctggaccatttaccggagaa
atttctcctattatgttaaaagatattggaataaaatatgttattattggtcattcagaa
agacgattaaatcataaagaaacaaatgaaataattgcaaaaaaattttgtatgttaaaa
gaagaaaatttagttcctatattatgtattggagaaacaaaaaaagaaaaaattgataaa
aaaactaaagatatatgtaaaaaacaaattgatattatatttaatatgtatggttctaat
gcatttgataattctattatcgcatatgaacctatttggtcgattggttcaggtaattca
gcagcaccaaaagaagttcaatgtattgcacattttatacgtaattatgtaaaaagtaaa
tcaaatcataatattgaaaatttttttattcaatatggaggatctgttacaaaaaataat
gcaaaagaactaatttatcaaaaagacattgatggttttttagtaggtggagcatcttta
caattagaagaattttctaaaattatagaaataacaaatatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system