KEGG   Buchnera aphidicola Cc: BCc_188Help
Entry
BCc_188           CDS       T00423                                 

Gene name
tpiA
Definition
hypothetical protein (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bcc  Buchnera aphidicola Cc
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:bcc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bcc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bcc00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bcc00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:bcc00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(221127..221891)
Genome map
AA seq 254 aa AA seqDB search
MIKPIIVGNWKLNGSKKLIESFLKQLNQFLIKYYKICTVVIAPPVLYSHLIQNMFSSDKK
NFFLGAQNIDIHFSGPFTGEISPIMLKDIGIKYVIIGHSERRLNHKETNEIIAKKFCMLK
EENLVPILCIGETKKEKIDKKTKDICKKQIDIIFNMYGSNAFDNSIIAYEPIWSIGSGNS
AAPKEVQCIAHFIRNYVKSKSNHNIENFFIQYGGSVTKNNAKELIYQKDIDGFLVGGASL
QLEEFSKIIEITNI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaccaataattgtagggaattggaaattaaatggaagtaaaaaattaattgaa
agttttttaaaacaattaaatcaatttttaattaaatattacaaaatatgtactgttgtt
attgcgccgcctgttttatattctcatttaattcaaaatatgttttcttctgataaaaaa
aatttttttttaggcgcccaaaatattgatattcatttttctggaccatttaccggagaa
atttctcctattatgttaaaagatattggaataaaatatgttattattggtcattcagaa
agacgattaaatcataaagaaacaaatgaaataattgcaaaaaaattttgtatgttaaaa
gaagaaaatttagttcctatattatgtattggagaaacaaaaaaagaaaaaattgataaa
aaaactaaagatatatgtaaaaaacaaattgatattatatttaatatgtatggttctaat
gcatttgataattctattatcgcatatgaacctatttggtcgattggttcaggtaattca
gcagcaccaaaagaagttcaatgtattgcacattttatacgtaattatgtaaaaagtaaa
tcaaatcataatattgaaaatttttttattcaatatggaggatctgttacaaaaaataat
gcaaaagaactaatttatcaaaaagacattgatggttttttagtaggtggagcatcttta
caattagaagaattttctaaaattatagaaataacaaatatttaa

DBGET integrated database retrieval system