KEGG   Buchnera aphidicola Cc (Cinara cedri): BCc_283Help
Entry
BCc_283           CDS       T00423                                 

Gene name
recD
Definition
hypothetical protein (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bcc  Buchnera aphidicola Cc (Cinara cedri)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BCc_283 (recD)
Enzymes [BR:bcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BCc_283 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
323110..324891
Genome map
AA seq 593 aa AA seqDB search
MLSKNIKKFFKIIKIAKKKKEINCIDYYTCINKKISNYSPEVILVILYLIYSARHGHSCI
PKKHFVKKKIKRKNVFIKLLNIVSKNNINWFNTVISSMLCSNGTQKTPLVIDKKYIYLYK
YWYSENKIIELLYQKKSKKKKNKIEYKKLIKKYCSNYIDKNQKNAVKKALIHNLFFLLGG
PGTGKTNIIAYLILILIKISKKKIKIQLTAPTGKAVNKLTQSIYKILKKKNIQKNEKKMI
PKEGITLHKLFKIQKETNKNNAKYIKRKKKIDILIIDESSMISLNIMEIILTCIKKKTKI
IFVGDVYQLPSVETGSILKKICNFKKKKKEKKKIFFVLKKNYRFNKNSGINFLINQLKKK
KIKDINKIYKKKYKDIIWKNLNTSNDYLNMLKKIKLYYKKYWNYVNKKKNPKKIIHKFNK
YRILCIINKGIFGTKKINQYLDNYFIKINNKKKKKEFWYHGKPIIIKKNNIFLKLMNGDI
GICLYKKKKKKIYFLLSTGKIKKFNPEILFHYKTAWSTTIHKSQGSEFLSVNIIIPNYFS
NKFSKELFYTAISRAQKKVTIYANKKILNKIINNNKERYSGLKKKIEELNIFS
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgttatctaaaaatataaaaaaattttttaaaataataaaaattgcaaaaaagaaaaaa
gaaataaattgtatagattattacacatgtattaataaaaaaatttcaaattattcacct
gaagttatattagtaattctttacttaatatattcagctcgacatggacatagttgtata
ccaaaaaaacattttgttaaaaaaaaaataaaaagaaaaaatgtgtttataaaattatta
aatattgttagtaaaaataatattaattggtttaatactgtaataagtagcatgttatgt
agtaacggcacacaaaaaacacctcttgtaattgacaaaaaatatatttatttatataaa
tattggtattcagaaaataaaataattgaattgctttatcaaaaaaaaagtaaaaaaaaa
aaaaataaaatagaatataaaaaattaataaaaaaatattgttcaaattatattgataaa
aatcaaaaaaatgcagttaaaaaagctttaattcataatttgttttttcttcttggtggt
ccaggcacaggaaaaacaaatataatagcttatttaattttaattttaattaaaatatca
aaaaaaaaaataaaaattcaattgacagctcctacaggaaaagcggtaaacaaactaact
caatctatatataaaatattaaaaaaaaaaaacattcaaaaaaatgaaaaaaaaatgata
cctaaagaaggaattacattacataaattatttaaaattcaaaaagaaactaataaaaat
aatgcgaaatatataaaaagaaaaaaaaaaattgatattcttatcattgatgaatcatct
atgattagtttaaatataatggaaataatattaacatgtataaaaaaaaaaacaaaaata
atttttgttggagatgtatatcaattaccttctgtagaaactggatcaattttaaaaaaa
atatgtaattttaaaaaaaaaaaaaaagaaaaaaaaaaaattttttttgtattaaaaaaa
aattatagatttaataaaaattcaggaattaatttcttaattaatcaattaaaaaaaaaa
aaaatcaaagatattaataagatttataaaaaaaaatataaagatataatatggaaaaat
ttaaatacatcaaatgattatttaaatatgcttaaaaaaataaaattatattataaaaaa
tattggaattatgtaaataaaaaaaaaaatccaaaaaaaattattcataaatttaataaa
tatcgtatattatgtataataaataaaggtatatttggaactaaaaaaataaatcaatat
ttagataattattttataaaaataaataataaaaaaaaaaaaaaagaattttggtatcac
ggaaaacctattataattaaaaaaaataatatatttttaaaattaatgaatggagatata
ggaatttgtttatataaaaaaaaaaagaaaaaaatttattttttattatctactggaaaa
ataaaaaaatttaatccagaaattttatttcattataaaactgcttggtcaactaccatt
cataaatctcaaggatcagaatttttatctgtaaatattattattccaaattatttctct
aataaattttctaaagaattattttatactgctattagtagagctcaaaaaaaagttaca
atttatgcaaataaaaaaattttaaataaaattattaataataataaagaaaggtattct
ggtttaaaaaaaaaaatagaagaattaaatattttttcttaa

DBGET integrated database retrieval system