KEGG   Bartonella clarridgeiae: BARCL_0055Help
Entry
BARCL_0055        CDS       T01394                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bcd  Bartonella clarridgeiae
Pathway
bcd00300  Lysine biosynthesis
bcd01100  Metabolic pathways
bcd01120  Microbial metabolism in diverse environments
bcd01230  Biosynthesis of amino acids
Module
bcd_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bcd00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BARCL_0055 (dapE)
Enzymes [BR:bcd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BARCL_0055 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: CBI75736
UniProt: E6YFU8
Position
62782..63948
Genome map
AA seq 388 aa AA seqDB search
MLVLTDPVQLLQALIRCPSVTPHEAGVLSTLEHFLRKMGFCVERPVFVDKNTEDVENLYA
KIGSEGPHLMFAGHSDVVPPGELENWTYPPFEGVINQGRLYGRGAVDMKGGIACFIAALA
RFLKKKSLKGMVSFLITGDEEGPAINGTVKLLEWAVKKGEKWNAAIVGEPTSINIVGDTI
KIGRRGSISGIITVKGYQGHVAFPERAANPLPLANKLIQALTQNALDQGTKDFQASHLEL
TSIDTGNFSVNIIPAQTVIRFNIRYNDLWTKETLIAEIEKRLAFVHSKNDQVPYYQLEWI
YGLGGVFLTKNDKLVGILSNAIKSITGNIPECSTSGGTSDARFIKDYCPVVEFGLPGQTM
HMVDEYVTLDAIENLTSIYERFITDFFA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcttgttcttacagatcctgttcagcttttacaggcacttattcggtgcccttctgtt
acacctcatgaagcaggagttttatcgactttggaacactttttaagaaaaatgggattt
tgtgttgagcgtcctgtttttgttgataaaaatacggaagatgttgaaaatctttatgca
aaaataggcagtgaaggtccacatcttatgtttgctggtcatagtgatgtggtgccgccc
ggtgaactagaaaactggacttatcctccttttgagggagtaatcaaccaaggaagatta
tatgggcgaggtgctgttgatatgaagggtgggatcgcttgttttatagcagcactagct
cggtttctgaaaaaaaaatcactcaagggaatggtaagctttttaataactggtgatgaa
gaaggtcctgccataaacggtacagtaaagcttttagaatgggcagtaaaaaaaggtgaa
aaatggaatgcagccattgtgggtgaaccaacaagcataaatattgttggtgatacgatc
aagattggacggcgaggatcgatttctggtattattacggttaaaggttatcaaggtcat
gttgcttttcctgagcgagcagcaaatccattgcctttagcaaataagcttattcaagcg
ttgacacaaaatgctttggatcaaggaacaaaggattttcaagcaagtcatttggaatta
acaagcattgatacaggaaatttttctgtcaatattattccagcacaaacagtcattcgc
tttaatatacgctacaatgatctttggacaaaagaaacactcattgctgaaattgagaag
cgccttgcttttgtgcattctaaaaatgatcaagtaccatattatcagcttgaatggata
tacggtttaggaggggttttcttgacaaaaaatgataaactggttggaattttgtcgaat
gctattaaaagtataacagggaacattccggaatgttcaacttctggtggcacctcagat
gcgcgttttattaaagattattgcccagttgttgagtttggtttgccagggcaaactatg
cacatggtggatgaatatgtgactcttgatgctatagaaaacctaacttctatttatgaa
cgttttattactgatttttttgcataa

DBGET integrated database retrieval system