KEGG   Bartonella clarridgeiae: BARCL_0055Help
Entry
BARCL_0055        CDS       T01394                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bcd  Bartonella clarridgeiae
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bcd01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bcd00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
62782..63948
Genome map
AA seq 388 aa AA seqDB search
MLVLTDPVQLLQALIRCPSVTPHEAGVLSTLEHFLRKMGFCVERPVFVDKNTEDVENLYA
KIGSEGPHLMFAGHSDVVPPGELENWTYPPFEGVINQGRLYGRGAVDMKGGIACFIAALA
RFLKKKSLKGMVSFLITGDEEGPAINGTVKLLEWAVKKGEKWNAAIVGEPTSINIVGDTI
KIGRRGSISGIITVKGYQGHVAFPERAANPLPLANKLIQALTQNALDQGTKDFQASHLEL
TSIDTGNFSVNIIPAQTVIRFNIRYNDLWTKETLIAEIEKRLAFVHSKNDQVPYYQLEWI
YGLGGVFLTKNDKLVGILSNAIKSITGNIPECSTSGGTSDARFIKDYCPVVEFGLPGQTM
HMVDEYVTLDAIENLTSIYERFITDFFA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcttgttcttacagatcctgttcagcttttacaggcacttattcggtgcccttctgtt
acacctcatgaagcaggagttttatcgactttggaacactttttaagaaaaatgggattt
tgtgttgagcgtcctgtttttgttgataaaaatacggaagatgttgaaaatctttatgca
aaaataggcagtgaaggtccacatcttatgtttgctggtcatagtgatgtggtgccgccc
ggtgaactagaaaactggacttatcctccttttgagggagtaatcaaccaaggaagatta
tatgggcgaggtgctgttgatatgaagggtgggatcgcttgttttatagcagcactagct
cggtttctgaaaaaaaaatcactcaagggaatggtaagctttttaataactggtgatgaa
gaaggtcctgccataaacggtacagtaaagcttttagaatgggcagtaaaaaaaggtgaa
aaatggaatgcagccattgtgggtgaaccaacaagcataaatattgttggtgatacgatc
aagattggacggcgaggatcgatttctggtattattacggttaaaggttatcaaggtcat
gttgcttttcctgagcgagcagcaaatccattgcctttagcaaataagcttattcaagcg
ttgacacaaaatgctttggatcaaggaacaaaggattttcaagcaagtcatttggaatta
acaagcattgatacaggaaatttttctgtcaatattattccagcacaaacagtcattcgc
tttaatatacgctacaatgatctttggacaaaagaaacactcattgctgaaattgagaag
cgccttgcttttgtgcattctaaaaatgatcaagtaccatattatcagcttgaatggata
tacggtttaggaggggttttcttgacaaaaaatgataaactggttggaattttgtcgaat
gctattaaaagtataacagggaacattccggaatgttcaacttctggtggcacctcagat
gcgcgttttattaaagattattgcccagttgttgagtttggtttgccagggcaaactatg
cacatggtggatgaatatgtgactcttgatgctatagaaaacctaacttctatttatgaa
cgttttattactgatttttttgcataa

DBGET integrated database retrieval system