KEGG   Bartonella clarridgeiae: BARCL_0178Help
Entry
BARCL_0178        CDS       T01394                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
bcd  Bartonella clarridgeiae
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bcd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BARCL_0178
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BARCL_0178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
196884..197381
Genome map
AA seq 165 aa AA seqDB search
MIVVVGISTISNMIYDDSVQHSYKITNDDTLKETQNMSDESLLLSDLLKQGDLENGRKIF
RQCAICHTSKRDEFNRIGPPLWGIVNRPFAIVKNFSYSKVLRANSDKKWDFFTLDRYLQS
PRQAFPGTIMSFRGIKNDQDRADLLLYLRSLSDHSIPLPQDDEQD
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
ttgattgttgtagtgggcatttctactatcagcaatatgatttatgatgattcagtccaa
cattcttataaaattaccaatgatgatacgcttaaagaaacacaaaatatgtctgatgaa
tccttattgttgagtgaccttcttaaacaaggtgatcttgagaatgggcggaaaattttt
cgtcagtgtgcgatctgccatacttctaaacgtgatgaatttaatcgtattggtccacca
ctttgggggatcgttaaccgtccttttgcaattgtaaaaaatttttcttattcaaaagta
ttgcgtgcgaattctgataaaaaatgggatttttttactttggatcgttatcttcaatca
ccgcgtcaagcttttccaggaacgattatgtcttttcgtggaattaaaaatgatcaagac
cgcgctgatcttttactctatttacgcagcttatctgatcattctatccctctaccacaa
gatgatgaacaagattag

DBGET integrated database retrieval system