KEGG   Bartonella clarridgeiae: BARCL_0178Help
Entry
BARCL_0178        CDS       T01394                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
bcd  Bartonella clarridgeiae
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bcd00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bcd02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
196884..197381
Genome map
AA seq 165 aa AA seqDB search
MIVVVGISTISNMIYDDSVQHSYKITNDDTLKETQNMSDESLLLSDLLKQGDLENGRKIF
RQCAICHTSKRDEFNRIGPPLWGIVNRPFAIVKNFSYSKVLRANSDKKWDFFTLDRYLQS
PRQAFPGTIMSFRGIKNDQDRADLLLYLRSLSDHSIPLPQDDEQD
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
ttgattgttgtagtgggcatttctactatcagcaatatgatttatgatgattcagtccaa
cattcttataaaattaccaatgatgatacgcttaaagaaacacaaaatatgtctgatgaa
tccttattgttgagtgaccttcttaaacaaggtgatcttgagaatgggcggaaaattttt
cgtcagtgtgcgatctgccatacttctaaacgtgatgaatttaatcgtattggtccacca
ctttgggggatcgttaaccgtccttttgcaattgtaaaaaatttttcttattcaaaagta
ttgcgtgcgaattctgataaaaaatgggatttttttactttggatcgttatcttcaatca
ccgcgtcaagcttttccaggaacgattatgtcttttcgtggaattaaaaatgatcaagac
cgcgctgatcttttactctatttacgcagcttatctgatcattctatccctctaccacaa
gatgatgaacaagattag

DBGET integrated database retrieval system