KEGG   Bartonella clarridgeiae: BARCL_0561Help
Entry
BARCL_0561        CDS       T01394                                 

Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bcd  Bartonella clarridgeiae
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bcd00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bcd00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:bcd03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:bcd03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bcd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
606348..606797
Genome map
AA seq 149 aa AA seqDB search
MVDILFYHLTKSTLKETLPVLVERALKRFGRITIQCVSKEQCNFIDTCLWVYADESFIGH
GTEYDKYPDLQPVFLTIGQENPNGSKVRFLIEGAICSDIDIYQRLVIMFDGHNDEQLNLI
RKQWKEYKTKNYYLTYWQQTEDHRWEQQV
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggttgatattttgttctatcatttgacgaagtcaactctaaaagagactttgcctgta
ttagtggaacgtgcattgaagcgttttggtagaataacaatacaatgtgtgagtaaagaa
caatgcaattttatagatacttgtctatgggtttatgccgatgaatcatttattgggcat
ggaacagaatatgataaatatccagatttgcagcctgtatttcttactataggacaagaa
aatccgaatggctcaaaagtgcgctttcttatagagggagcaatttgttcagatattgat
atttatcaacgacttgtcattatgtttgatggtcataatgatgagcaattgaatcttatt
cgtaagcagtggaaagaatataaaacaaaaaattattatttaacttattggcagcagact
gaagatcatcgttgggagcaacaggtttga

DBGET integrated database retrieval system