KEGG   Bartonella clarridgeiae: BARCL_0586Help
Entry
BARCL_0586        CDS       T01394                                 

Gene name
tpiA
Definition
(RefSeq) Triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bcd  Bartonella clarridgeiae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BARCL_0586 (tpiA)
   01230 Biosynthesis of amino acids
    BARCL_0586 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BARCL_0586 (tpiA)
   00051 Fructose and mannose metabolism
    BARCL_0586 (tpiA)
   00562 Inositol phosphate metabolism
    BARCL_0586 (tpiA)
Enzymes [BR:bcd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BARCL_0586 (tpiA)
Exosome [BR:bcd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BARCL_0586 (tpiA)
  Exosomal proteins of bladder cancer cells
   BARCL_0586 (tpiA)
  Exosomal proteins of melanoma cells
   BARCL_0586 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
643548..644312
Genome map
AA seq 254 aa AA seqDB search
MASDIQPLVAGNWKMNGTGESLGELRAIAAGVSSDLGFLFEALICIPNTLLSRASDILHS
EKLLLGGQNCHFKDSGPYTGDVSAFMLKEAGASYVIIGHSERRMAYHENDDIICAKVKAA
WREGLVALVCIGETLEERANGKVFDILTQQLENSLPDGSTGKNIVIAYEPVWAIGTGRIP
TLADVGKIHSFIRERISFRFGDDGCKIRLLYGGSVTPSNAFELLSITHVNGALIGGASLK
AVDFLNICDVYRRL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggatattcagccgttggttgctggaaattggaaaatgaatgggacgggtgaa
tctcttggagaattacgtgctattgctgctggtgttagctctgatttgggctttttattt
gaagcacttatttgtattccaaatacacttttatcacgtgcttctgatatacttcatagc
gaaaaacttcttttaggagggcaaaactgccattttaaagatagtggtccttatactgga
gatgtttcggcatttatgcttaaggaggcaggagctagttatgttattattggacattca
gagcgccgtatggcatatcatgaaaatgatgacattatttgtgctaaagtaaaagctgca
tggcgagaaggtcttgttgctcttgtttgtattggtgaaacgttagaagagcgagcaaat
ggtaaagtcttcgatatacttacacaacagcttgagaattctttgccagatggttcaaca
ggaaaaaatatagttatcgcttatgagccggtgtgggctataggtacaggaagaattcct
actttggcagatgttgggaaaatccatagttttattcgtgagaggattagctttcgcttt
ggtgatgatggatgtaaaatacgcttgctttatggcggatcagtaacaccatctaatgca
tttgagcttttgagtattacccatgttaatggtgctttgattggtggagcaagcttaaaa
gcagttgattttttaaatatttgcgatgtttatcgtagattataa

DBGET integrated database retrieval system