KEGG   Bartonella clarridgeiae: BARCL_0595Help
Entry
BARCL_0595        CDS       T01394                                 

Gene name
pdhC
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcd  Bartonella clarridgeiae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:bcd01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bcd00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bcd00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bcd00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
652372..653697
Genome map
AA seq 441 aa AA seqDB search
MPIKITMPALSPTMEEGNLSKWNVKEGDKVTCGDIIAEIETDKATMEIEAIDEGTVAKIV
VPAGTQRVKVNSLIVVLAEEGEDLSEAAKIAEETSSIMVKEPVIKQSMNSASVQASHSSK
NQQLIQRNGNNRRLFASPLARRLAAQVGIDLSLISGTGPHGRIIKHDVEKVLNNGLESSR
SLHINQSITSSISDRHILQLFKESEYTFAPHDNMRKTIAKRLVASKQMVPHFYVTIDCEL
DALLKLRTQLNAVVPMVEMQEGTKKPAYKLSVNDMVIKAVALSLKAVPDANVSWLEDGML
YHKHCDVGVAVSVPNGLMVPIIRCAEEKSLSIISNEMKDLATRARERKLRMEEYQGGTTA
VSNMGMYGIKNFSAIINPPHATIFAIGSGEKRAIVKDGALAIATVMSVTLSVDHRAVDGA
LAAEVAQTFKKIIENPLTMLI
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcctattaagattacgatgcctgcgctttctcctacaatggaagaaggaaatttatca
aaatggaatgtcaaagaaggtgataaggttacatgtggtgatattattgctgaaattgaa
acagataaagcaacaatggaaatagaagctattgatgaaggaacagttgctaaaattgtt
gttcctgctggaacacagagagttaaagtcaatagtctgattgtcgttttagcagaagaa
ggtgaagatctatctgaagctgcaaaaattgcagaagaaacttcttctattatggtgaaa
gaaccagtcattaaacaatcgatgaactcagcgagtgtacaagcttctcattcatcaaaa
aatcagcaattaatacaacgaaatggaaataatagacgtctttttgcatctcctttagca
agacgattggcagctcaagtggggatcgatttatcacttatttctggtactggtcctcat
ggacgtatcattaaacatgatgtggagaaagttctgaataatggtcttgaaagttctcgt
tcattgcacatcaaccagtcaataacttcaagtatttctgatagacatattttgcaattg
tttaaagagagtgaatatacatttgcaccccatgataatatgcgtaaaacaattgctaag
cgtttggttgcatcaaagcagatggtaccgcatttttatgtaacaatagattgtgaatta
gatgcgttattgaaattgcgcacgcaactgaacgctgttgttccaatggttgagatgcaa
gagggcacgaagaagcctgcttataagctatctgtcaatgatatggttattaaagctgta
gcgctttctttaaaagctgtacctgatgctaatgtgtcatggcttgaagatggaatgctt
tatcacaaacactgtgatgttggtgttgctgtttctgttccaaatgggttaatggtacca
attattcgctgtgcagaagagaaatctttgtcaatcatttctaatgagatgaaagatctt
gcaacgcgtgctcgtgaacgtaaattgagaatggaggaatatcaaggagggacaacagct
gtatcaaatatggggatgtatggcataaaaaatttttctgctattattaatccgccgcat
gcaacgatttttgcaattggttcaggtgagaagcgtgctattgttaaagatggtgcatta
gcaatagcaacagttatgtcggttactctttcagttgatcatcgtgctgttgatggagca
ctagcggcagaagttgctcagacttttaagaagataattgaaaatcccttaacgatgtta
atttag

DBGET integrated database retrieval system