KEGG   Bartonella clarridgeiae: BARCL_0847Help
Entry
BARCL_0847        CDS       T01394                                 

Definition
Lysophospholipase l2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bcd  Bartonella clarridgeiae
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bcd00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BARCL_0847
Enzymes [BR:bcd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BARCL_0847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
938692..939576
Genome map
AA seq 294 aa AA seqDB search
MKTPFDSTASNSPLSNMHSSSYLKIANDREIRFAITNSATKKAKGTVVILENYADAIEEY
FLPMNEISQRGFYTTIFDWFGREENQPNKQKWNRHNYFDINNYINNLSEFLKNFVYLNCP
PPYYMLTYGMGGLIALNGLSLINHQFNRMLCVSPLFAPLGNKTNSFQHKLTQFFSDIGFG
FLPVKSEKKLKQANTQSNLLFNRPTSRWMSSTLNAISAMKTNILHGNLQIPTLFILANQN
NIVNNIEVRRLCRSTRLTDSITIIGAELDTIMRKENYRKQFWAAFDAFIHSNYQ
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacaccttttgattctacagcctcgaattctcctctctctaatatgcatagtagt
agctatttaaaaatagccaacgatcgtgagattcgatttgcaataacaaattctgcaaca
aaaaaagctaaaggaactgttgttattcttgaaaattatgcagatgctatagaagaatat
tttttaccaatgaatgaaatctcccaacgcggtttttataccacgatatttgattggttt
ggtcgagaggaaaatcaacctaataaacaaaaatggaatcggcataattatttcgatatt
aacaattatattaataatttatcagaatttcttaaaaattttgtttatctaaattgtcct
ccaccttactatatgcttacttatggtatgggagggttaatagcacttaacggattaagc
cttatcaatcaccaattcaacagaatgctttgcgtttctcccctttttgctccattaggt
aataaaacaaatagttttcaacataaattaacacaatttttttccgatataggttttggt
ttcttacctgttaaaagtgaaaaaaaattaaaacaggcaaatacgcaatctaatcttctt
ttcaatcgaccaacatctcgatggatgtcctcaacactcaatgcaatcagcgcaatgaaa
acaaatatacttcatggaaatttacaaattccaacactgtttatccttgctaatcaaaat
aatattgtgaataatattgaagtgcgacgattatgtcgatcaacgcgtttgacagacagt
atcacaattataggagctgaactcgatacgataatgcgtaaagaaaactatcgtaaacag
ttttgggctgcatttgatgcctttattcatagcaattatcaataa

DBGET integrated database retrieval system