KEGG   Bartonella clarridgeiae: BARCL_0847Help
Entry
BARCL_0847        CDS       T01394                                 

Definition
Lysophospholipase l2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bcd  Bartonella clarridgeiae
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bcd00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
938692..939576
Genome map
AA seq 294 aa AA seqDB search
MKTPFDSTASNSPLSNMHSSSYLKIANDREIRFAITNSATKKAKGTVVILENYADAIEEY
FLPMNEISQRGFYTTIFDWFGREENQPNKQKWNRHNYFDINNYINNLSEFLKNFVYLNCP
PPYYMLTYGMGGLIALNGLSLINHQFNRMLCVSPLFAPLGNKTNSFQHKLTQFFSDIGFG
FLPVKSEKKLKQANTQSNLLFNRPTSRWMSSTLNAISAMKTNILHGNLQIPTLFILANQN
NIVNNIEVRRLCRSTRLTDSITIIGAELDTIMRKENYRKQFWAAFDAFIHSNYQ
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacaccttttgattctacagcctcgaattctcctctctctaatatgcatagtagt
agctatttaaaaatagccaacgatcgtgagattcgatttgcaataacaaattctgcaaca
aaaaaagctaaaggaactgttgttattcttgaaaattatgcagatgctatagaagaatat
tttttaccaatgaatgaaatctcccaacgcggtttttataccacgatatttgattggttt
ggtcgagaggaaaatcaacctaataaacaaaaatggaatcggcataattatttcgatatt
aacaattatattaataatttatcagaatttcttaaaaattttgtttatctaaattgtcct
ccaccttactatatgcttacttatggtatgggagggttaatagcacttaacggattaagc
cttatcaatcaccaattcaacagaatgctttgcgtttctcccctttttgctccattaggt
aataaaacaaatagttttcaacataaattaacacaatttttttccgatataggttttggt
ttcttacctgttaaaagtgaaaaaaaattaaaacaggcaaatacgcaatctaatcttctt
ttcaatcgaccaacatctcgatggatgtcctcaacactcaatgcaatcagcgcaatgaaa
acaaatatacttcatggaaatttacaaattccaacactgtttatccttgctaatcaaaat
aatattgtgaataatattgaagtgcgacgattatgtcgatcaacgcgtttgacagacagt
atcacaattataggagctgaactcgatacgataatgcgtaaagaaaactatcgtaaacag
ttttgggctgcatttgatgcctttattcatagcaattatcaataa

DBGET integrated database retrieval system