KEGG   Bartonella clarridgeiae: BARCL_0973Help
Entry
BARCL_0973        CDS       T01394                                 

Gene name
folA
Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bcd  Bartonella clarridgeiae
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bcd00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bcd00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1069923..1070432)
Genome map
AA seq 169 aa AA seqDB search
MTLPICLIAAVSQNSVIGRAGAMPWRLSTDLQRFKALTLNKPIVMGRKTWDSLRHPLPDR
TNIVITRNRTLISEGAVIAHSLSQACNIAEEVACQSGADAIFIIGGGEIFQQGLQIADKI
FLTEILACIEGDSFFPVFDKEKWTIVKTQYIPESDKDNYPTRFVIYERK
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgactcttccaatttgtttaattgcagctgtttcgcaaaacagtgttataggtcgtgca
ggtgcaatgccttggcgtttgtcaacagatttgcaacgttttaaagctttaactttaaat
aagcccattgttatgggacggaaaacttgggattctcttagacatcccttaccagatcgc
acgaatattgtcattactcgtaatcgtacattgatctctgaaggtgctgttattgctcat
tctttatctcaagcttgtaatattgcagaagaggtagcttgtcagagtggtgcggatgca
atttttattattggtggtggtgaaatttttcaacaaggtttgcagatagctgataaaata
tttcttactgagatcttagcttgtattgaaggtgatagtttttttcctgtttttgataaa
gaaaagtggactattgttaaaacacaatatattccagaaagtgataaagacaattatcca
acacgttttgtgatttatgaacggaaatga

DBGET integrated database retrieval system