KEGG   Bartonella clarridgeiae: BARCL_1003Help
Entry
BARCL_1003        CDS       T01394                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6 diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bcd  Bartonella clarridgeiae
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bcd00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bcd00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1109975..1111426)
Genome map
AA seq 483 aa AA seqDB search
MLLGELFIECIKDDYFASIDITGISADSRQILPGYVFVALKGNQRDGREYVNDAIKRGAR
VIVTDHNFVFENSLVPVVRVLNVRHSLAIAAARFYNSQPEIMVAVTGTSGKTSVVSFIRQ
IWKYVGCCAASIGTVGVVSPKRHDLGSLTTPDPVMLQRLLCEIANEGVTHAALEASSHGL
DQCRIDGVRLAAAAFTNLGRDHMDYHKCIEDYFHAKMRLFNTLLPQDAPALIFADDIYSQ
KVIDIVRRAHRQVLTIGRTGKFITLNRVEHQRLKQCVECRMGNNIYTFDLPLVGDFQVAN
ALMAAGLAIATRASPDMVFRSLEKLQGAPGRLELVGKTEDGAPVYVDYAHKPEALEQVLL
SVRPFTQGRLILVFGCGGDRDQGKRALMGTIAGNKADIVIVTDDNPRTEAPEKIRKDILQ
AVPEAIEIADRAEAIYYAVRLLKTGDTLIVAGKGHENGQIIGQKTYPFSDRLQVIAALKE
LNK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgttgcttggagaattatttatagaatgtattaaagatgattattttgcatcaattgac
attacagggataagcgctgattctcgtcagatattgccaggttatgttttcgtggcgctt
aagggaaatcaaagggatggcagagagtatgtaaatgatgctataaagcgtggtgcgcgg
gtaatcgttacagatcataattttgtttttgagaattcacttgttcctgttgttcgtgtt
ttgaatgtacgtcatagtttagctatagcagctgcccgtttttataattctcaacctgaa
ataatggtggctgttacaggtacaagtggtaagacatcggttgtatcttttattcggcaa
atttggaaatatgttggttgttgtgctgctagtataggaacagtaggtgttgtctcccct
aaacgtcatgatcttggttctctaaccacacctgatccagtgatgttacagcgtttgtta
tgtgaaattgccaatgaaggtgtcacacatgctgcccttgaagcttcttcacatgggctt
gatcaatgtcggattgatggagtgcgtttagctgcggctgcttttaccaatttagggcgt
gatcatatggattatcacaagtgcatagaggattattttcacgctaagatgagattattt
aatacgcttttaccgcaagacgcgcctgctcttatttttgcggatgatatttattcacaa
aaggttatcgatattgttaggcgagctcaccggcaagttttgacaattggacgcacaggg
aaattcatcacacttaatcgtgttgaacatcaacgattaaaacaatgtgttgaatgtcgg
atgggaaataatatttatacatttgatttgcctcttgttggcgattttcaagtagctaat
gcacttatggctgcaggtttagcaattgcgacacgtgcatctccagatatggtttttcgt
tctcttgaaaaattacaaggggcacctggtcggttagaattggttggaaaaacagaagat
ggagcacctgtttacgtcgattatgcgcataagccagaggccttagaacaggtattactt
tctgttcgtccttttacgcaaggacgtttaattcttgtttttggttgtggtggtgatcgc
gatcaaggaaagagagctttgatgggaacaattgcaggaaataaagctgatattgtaatt
gtaactgacgataaccctcgtacggaagcaccggagaaaattcgaaaagatattttacaa
gcggtgccggaagcaatagaaatagcggatcgtgctgaagcaatttattatgcagtgaga
ttgctgaaaactggagatacattaattgttgcaggaaaaggtcacgaaaatggacaaatt
atagggcaaaaaacatatcctttctcagatcgtttgcaagtgattgctgctttaaaggaa
ctgaataaatga

DBGET integrated database retrieval system