KEGG   Bartonella clarridgeiae: BARCL_1014Help
Entry
BARCL_1014        CDS       T01394                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bcd  Bartonella clarridgeiae
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bcd00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1121000..1121608
Genome map
AA seq 202 aa AA seqDB search
MKKKALIVIDVQNDFLPSGALAIPESNAILPAVNNLISRFDHVILTQDWHPKNHCSFASF
HLEKTPYDTVKLDYGLQILWPDHCIQGTQGAEFHTSLEVEKAQLILRKGYNKEIDSCSAF
FENDQKTPTGLHGYLKEHDFTTLFMCGLATDFCVGFSALHAVKCGFKVSVLLNACAGIDL
NGSLNTMLKVMNEAGVELLMVS
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaagccttaatcgttattgatgttcaaaatgatttcttaccaagcggagca
cttgcaataccagaaagcaatgccattctccctgctgttaataaccttatatcccgtttt
gatcatgttattttaacccaagattggcatccaaaaaaccactgtagctttgcttctttt
catcttgagaaaactccttatgatactgttaagcttgactatggccttcaaatactttgg
cctgatcattgtatacaaggaacacaaggagcggaatttcatacatctctcgaagttgaa
aaagcacaacttatccttcgaaaaggctataataaggaaattgatagttgttccgccttc
tttgaaaatgaccaaaaaacaccaacaggtttacacggttatcttaaagaacatgatttt
acaacattattcatgtgcggcttggcaactgacttttgtgttggattttctgcactgcat
gctgtaaaatgcggttttaaagttagtgttttgttgaacgcttgtgctggtattgatcta
aacggatcacttaatacaatgctcaaagttatgaatgaagctggtgtagaattgttgatg
gtctcctaa

DBGET integrated database retrieval system