KEGG   Bartonella clarridgeiae: BARCL_1018Help
Entry
BARCL_1018        CDS       T01394                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bcd  Bartonella clarridgeiae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bcd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BARCL_1018
Enzymes [BR:bcd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BARCL_1018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1124633..1124881)
Genome map
AA seq 82 aa AA seqDB search
MSRLGLAIGLASWISNDTLGIFTRQHFEKTSFDLSGLHVNPNAMTGIASITLSESGEDTI
IVAGRSNMAIKLEDIKKSNLLF
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
gtgagtagattaggtcttgctataggacttgctagttggattagtaatgatactttggga
atatttactcgccagcactttgaaaaaacttcttttgatttgagtggtttgcacgttaat
ccgaatgctatgactggtattgcttctattactctgagtgaaagcggggaggatacaatt
attgtcgcaggaagatctaatatggctattaagttagaagatattaagaaaagcaatttg
ttgttctga

DBGET integrated database retrieval system