KEGG   Bartonella clarridgeiae: BARCL_1030Help
Entry
BARCL_1030        CDS       T01394                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bcd  Bartonella clarridgeiae
Brite
Enzymes [BR:bcd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BARCL_1030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1143213..1143872)
Genome map
AA seq 219 aa AA seqDB search
MEQKGILRFREELASLVLKMRSKGIDDINFFAALERVPRQKFVSTPWLNSAYDNKVIPIE
CGEYIERLEEQLLILSALSLKKKHRVLEIGTGSGFCTALMACLSDRVTTVDRYKTLIDLA
RQRFENLGIENIIIRQIDGSRGVTGLGSFDRILIWPSRSNEPKECLELLAGNGILIQAIG
PDEGIQKVMRYTKIGSQFECSGMFQVRYQPFIENIAEVL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaaagggattttacgatttcgtgaagagttagcaagtcttgtgctaaaaatg
cgtagtaaaggcattgatgatataaacttttttgcggcattagagagagtcccacgtcag
aaatttgtctctactccttggcttaatagtgcttatgataataaagttattccgattgaa
tgtggagaatatattgagcgtctagaggagcagcttttaattctttcggcattatcgttg
aagaaaaaacatcgtgttttagaaattggtacaggttctggtttttgcactgcccttatg
gcttgtcttagtgatcgtgtgacaacggttgatcgttataaaacacttattgatttggca
cgacaaagatttgagaacttagggattgaaaacattattatacggcagatcgatggaagt
cgaggcgttacgggtttgggatcatttgatcgtattctcatttggccatcacgttctaat
gaaccaaaagaatgtttagaactgctagcgggaaatgggattctcattcaagctattgga
ccagatgaagggatacaaaaagtaatgcgttatacaaaaattggtagccagtttgagtgc
tcaggaatgtttcaagtgcgttatcaacccttcattgaaaatattgcagaagttctgtaa

DBGET integrated database retrieval system