KEGG   Bartonella clarridgeiae: BARCL_1042Help
Entry
BARCL_1042        CDS       T01394                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bcd  Bartonella clarridgeiae
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bcd00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1156536..1157444)
Genome map
AA seq 302 aa AA seqDB search
MISNAHVSREKCFYIFTPIKLNLALHIVGQRADGYHLLESLVYFSFSGDCLSYTPFESDR
FVVTGPFADRIVSDTGNLVIRARDFMRERFPKSAKPGFFRLVKTLPIASGIGGGSGDAAS
VLYMLRRQWKLDYSCEKLAEMSLVLGADVPMCLFALEYQQPLFVKGIGDDIIPVKEACSL
AMVLVNHGQHIATETIFKALEKCNHSHLKIDSSAFKTVFSLVESLQETRNDLFVPALKIA
PQLAEVLYALDKSGALFSRMSGSGATCFGIFKDQQAAQKAAFFIKSIYPDWFVKPIITLG
TR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatatcaaatgcacatgtttcgcgtgaaaagtgtttttatatatttacgcctattaag
ttgaatttagctttacatattgtagggcagcgtgctgatggctatcatttgttagaaagc
ttggtttatttcagttttagcggtgattgcttaagttatacgccttttgaaagtgatcgc
tttgttgtaacaggcccttttgcagatagaattgtttctgacacaggaaatttggttatc
cgcgcccgtgattttatgcgtgagagatttcctaaaagtgctaaacctggcttttttcgg
cttgttaaaacattgcctattgcatcaggtattggaggcggatcaggtgatgctgcaagc
gtattatatatgttacgtcggcaatggaaacttgattattcttgtgaaaaattagcagaa
atgagtttagttcttggagctgatgttccgatgtgtttgtttgcattggagtatcaacag
ccactttttgttaaaggaattggtgatgatataataccggtaaaagaggcttgttctctt
gcaatggtgttggttaatcatggtcagcacattgccacagagactatttttaaagcgtta
gaaaagtgtaatcattctcatttgaaaattgattcatctgccttcaaaacggttttttca
ttggttgagtctttacaagaaacgcgtaatgatctttttgttcctgcattaaaaattgct
cctcagttggctgaagtcttatatgcattggataaaagtggagctcttttttctcgtatg
tctggttcaggtgcaacgtgttttgggatttttaaagatcagcaagcagcacaaaaagca
gctttttttattaaatcaatatatccagattggtttgtgaaacctataataactttaggt
acacgatga

DBGET integrated database retrieval system