KEGG   Bartonella clarridgeiae: BARCL_1169Help
Entry
BARCL_1169        CDS       T01394                                 

Definition
phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bcd  Bartonella clarridgeiae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1310404..1311063)
Genome map
AA seq 219 aa AA seqDB search
MRKISKEGLALIKQWEGLRLKAYQDAIGVWTIGYGHTAQAGEPIVQEGMEITHLEAEAVL
QKDLSQFEQTVEHEVKQSLTDEQFAALVSFCYNVGIEAFCNSTLLKKLNKGEYEAVPAEL
QKWTKANGKRLQGLVHRRAAEAGLWAKGAYVSSNYQKVETAEKASFFKAEVFAPLIASFS
GLTGFVTGQGPVQWALAGIMIVAVILGIILYINTVRKEQ
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaaatatcaaaagaaggacttgcactcattaagcaatgggaaggattacgctta
aaagcttatcaagatgctattggcgtgtggacaataggctatggtcatacagcgcaagca
ggagaacctattgtgcaagaaggtatggaaattacgcatcttgaagcagaagcagtgctc
caaaaagatttaagccaattcgagcaaaccgtggaacacgaagtgaaacagtccttaacc
gatgaacagtttgcagctcttgtgtccttttgttataatgtaggaatagaggccttttgc
aattctacgctcttaaaaaaattgaataaaggagagtatgaagccgtgccagctgagttg
caaaaatggacaaaagcaaatggaaaacgtttgcaagggcttgtgcatcgacgggcagct
gaggctggtttatgggctaaaggagcttatgtttcttctaattatcagaaagtggaaaca
gcagagaaagcttcttttttcaaagcagaagtttttgcgccattgattgcatctttttca
ggtcttacaggatttgttacgggacaaggtcctgtacaatgggctctagccggcattatg
attgtggccgttattttgggtataatcttgtatattaatacggtgaggaaagaacaatag

DBGET integrated database retrieval system