KEGG   Bartonella clarridgeiae: BARCL_1195Help
Entry
BARCL_1195        CDS       T01394                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bcd  Bartonella clarridgeiae
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BARCL_1195 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BARCL_1195 (murA)
Enzymes [BR:bcd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BARCL_1195 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1336325..1337617)
Genome map
AA seq 430 aa AA seqDB search
MDSIHIIGGNPLNGVIPISGAKNATLPLMVAALLTEGTLTLDNIPHLVDVEFLLRILNHH
GIGYAVEGRKSHQDSGYSRTIHFTAKKITTINAPYELVKKMRASFWVIGPLLARCREAYV
SLPGGCAIGTRPVDFILEGLKSLGAQIVIEQGYVHAKAPEGLKGGRYRFPKVTVGGTHVL
LMAAVMAKGTTILDNIACEPEVINLIQALKAMGAHISGEGTQTLTIHGVEKLNGAKIQVI
ADRIEAGTYAMAVAMTGGKVLLKNANPHHLTQVLECLKKTGLEIEIKPEGISVKRDPEKK
IIPVDIKTGPFPDFPTDLQAQFMALMTRAQGNAHITETIFENRFMHVQELVRLGAQITLS
GQTALIRGTDRLQGAQVMATDLRASVSLVIAALAAQGKTIVNRVYHLDRGFERLEEKLAQ
CGADIRRVTG
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggattctattcacattattggtggaaatcctcttaatggtgttattcctatttcaggg
gctaaaaatgctacactccctcttatggttgcggcattgctcacggaggggacacttact
ttggataatattcctcatctcgtcgatgtcgaattcttactgcgaatcctcaatcatcac
gggatcggttatgctgtcgaaggacgaaaatcacatcaagatagcggatattcaagaaca
attcattttacagcaaaaaaaataacaacaataaatgctccttacgaattagtgaagaaa
atgcgcgcaagcttttgggtcattggtccgctgctcgcacgatgtagagaagcttacgtt
tctttgcctggtggatgtgccatcggaacacggcccgtcgattttattctggaaggactc
aaaagtctaggagcacaaatcgttatcgaacaaggatatgtgcatgctaaagcaccagaa
gggctcaaaggcggacgctatcgtttccctaaagtaactgtcgggggaactcacgtgctc
ttgatggcagctgtcatggcaaaaggaacaaccattcttgataatatcgcttgtgaacca
gaagtcataaatctgattcaagcgctcaaggctatgggcgcacacatctctggagaaggt
acgcaaaccctcactatccacggagtcgaaaaactcaatggcgcaaaaattcaagttatt
gctgatcgaatcgaagcaggaacatatgctatggccgtggctatgacagggggaaaagtc
ttgctaaaaaatgcaaatcctcatcatcttacccaagtcctcgagtgcctcaaaaaaaca
gggctcgaaatcgaaataaaaccagaaggtatcagtgtaaaacgagatccagagaaaaaa
attatacccgtagatatcaaaacaggtcctttcccagattttccaacagatctacaggca
caatttatggctcttatgacacgagctcagggaaatgctcatatcaccgaaacaattttc
gaaaaccgatttatgcacgtacaggaattagtccgcttgggtgcacaaattacactgagt
ggacaaacagcacttatccgagggacagatcgtttgcaaggcgcacaagtgatggcaaca
gatttgcgcgcttccgtttctcttgttattgctgcgcttgccgcacagggaaaaacaatc
gtcaatcgcgtctatcatctcgatcgaggtttcgaacggttggaagaaaagttagctcaa
tgcggtgcagatattcgacgtgtaacaggatga

DBGET integrated database retrieval system