KEGG   Bartonella clarridgeiae: BARCL_1284Help
Entry
BARCL_1284        CDS       T01394                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcd  Bartonella clarridgeiae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bcd01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bcd00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bcd00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bcd00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bcd00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1415617..1416015
Genome map
AA seq 132 aa AA seqDB search
MTLKEILWKEKQKEAFVSLIHGLAKCVYLYNNHERFVQTYFSTYKGKYFTGDGCKRDSDG
YYWITGRIDDILNVSGHRLGTAELESALVSHPYVSEAAVVGYPHSIKGQGIYSFVTLIEG
MTSSEELRQNLI
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
ttgacgctcaaggaaatattgtggaaggagaagcagaaggaagcctttgtatcgctgatt
catggcctggccaaatgcgtatacctttataataaccatgagcgctttgtccaaacgtat
ttttccacatataaaggaaaatattttacaggcgatggttgtaaacgtgatagcgatggt
tattactggattacaggacgaattgatgatatacttaatgtttcgggtcacagactaggg
actgctgaacttgaatcagcgcttgtttcgcatccttatgtttcagaagcggccgtcgta
ggataccctcactctattaaaggacagggaatttatagttttgtaaccttaatagaaggg
atgacatcaagcgaggagttacgccaaaatcttatttaa

DBGET integrated database retrieval system