KEGG   Bartonella clarridgeiae: BARCL_1284Help
Entry
BARCL_1284        CDS       T01394                                 

Definition
(GenBank) protein of unknown function
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcd  Bartonella clarridgeiae
Pathway
bcd00010  Glycolysis / Gluconeogenesis
bcd00620  Pyruvate metabolism
bcd00640  Propanoate metabolism
bcd00680  Methane metabolism
bcd01100  Metabolic pathways
bcd01110  Biosynthesis of secondary metabolites
bcd01120  Microbial metabolism in diverse environments
bcd01130  Biosynthesis of antibiotics
bcd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BARCL_1284
   00620 Pyruvate metabolism
    BARCL_1284
   00640 Propanoate metabolism
    BARCL_1284
  Energy metabolism
   00680 Methane metabolism
    BARCL_1284
Enzymes [BR:bcd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BARCL_1284
Lipid biosynthesis proteins [BR:bcd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BARCL_1284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding_C AMP-binding
Motif
Other DBs
NCBI-ProteinID: CBI76956
UniProt: E6YJB8
Position
1415617..1416015
Genome map
AA seq 132 aa AA seqDB search
MTLKEILWKEKQKEAFVSLIHGLAKCVYLYNNHERFVQTYFSTYKGKYFTGDGCKRDSDG
YYWITGRIDDILNVSGHRLGTAELESALVSHPYVSEAAVVGYPHSIKGQGIYSFVTLIEG
MTSSEELRQNLI
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
ttgacgctcaaggaaatattgtggaaggagaagcagaaggaagcctttgtatcgctgatt
catggcctggccaaatgcgtatacctttataataaccatgagcgctttgtccaaacgtat
ttttccacatataaaggaaaatattttacaggcgatggttgtaaacgtgatagcgatggt
tattactggattacaggacgaattgatgatatacttaatgtttcgggtcacagactaggg
actgctgaacttgaatcagcgcttgtttcgcatccttatgtttcagaagcggccgtcgta
ggataccctcactctattaaaggacagggaatttatagttttgtaaccttaatagaaggg
atgacatcaagcgaggagttacgccaaaatcttatttaa

DBGET integrated database retrieval system