KEGG   Bartonella clarridgeiae: BARCL_1284Help
Entry
BARCL_1284        CDS       T01394                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcd  Bartonella clarridgeiae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BARCL_1284
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BARCL_1284
   00620 Pyruvate metabolism
    BARCL_1284
   00640 Propanoate metabolism
    BARCL_1284
  Energy metabolism
   00680 Methane metabolism
    BARCL_1284
Enzymes [BR:bcd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BARCL_1284
Lipid biosynthesis proteins [BR:bcd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BARCL_1284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1415617..1416015
Genome map
AA seq 132 aa AA seqDB search
MTLKEILWKEKQKEAFVSLIHGLAKCVYLYNNHERFVQTYFSTYKGKYFTGDGCKRDSDG
YYWITGRIDDILNVSGHRLGTAELESALVSHPYVSEAAVVGYPHSIKGQGIYSFVTLIEG
MTSSEELRQNLI
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
ttgacgctcaaggaaatattgtggaaggagaagcagaaggaagcctttgtatcgctgatt
catggcctggccaaatgcgtatacctttataataaccatgagcgctttgtccaaacgtat
ttttccacatataaaggaaaatattttacaggcgatggttgtaaacgtgatagcgatggt
tattactggattacaggacgaattgatgatatacttaatgtttcgggtcacagactaggg
actgctgaacttgaatcagcgcttgtttcgcatccttatgtttcagaagcggccgtcgta
ggataccctcactctattaaaggacagggaatttatagttttgtaaccttaatagaaggg
atgacatcaagcgaggagttacgccaaaatcttatttaa

DBGET integrated database retrieval system