KEGG   Bacillus cereus ATCC 14579: BC0026Help
Entry
BC0026            CDS       T00127                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bce00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BC0026 (recR)
DNA repair and recombination proteins [BR:bce03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BC0026 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
27447..28043
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVC
GHITDRDPCYICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMEGIGPE
DINIPQLLKRLHDETVQEVILATNPNIEGEATAMYISRLLKPTGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaaccaatatcaaaactaatcgatagttttatgaagttgccaggtatc
ggaccgaaaacagcggttcgattggcatttttcgtattagatatgaaagaagatgatgtg
ttaggtttcgcgaaagcacttgtaaatgcgaagcgagatttagcgtactgttctgtatgc
ggacatattactgatcgtgatccttgttatatttgtaatgattcacatcgagatcaatca
gttgtttgtgtcgtgcaagaaccgaaagatgtaatcgcgatggaaaaaatgaaagagtat
caaggtgtatatcatgtgttacgtggtgcgatttctcctatggagggaattggaccggaa
gacattaatatcccgcaactcttaaagcgactacatgatgaaacggtacaagaagtgata
ttagcaacaaaccctaatattgaaggggaagctacagcgatgtatatctcccgcctctta
aaacctacaggcattaaagtaactcgtattgcacatggtctgccagttggtggagattta
gaatatgcagatgaagtgacattatccaaagcgttagaagggcgcagagaagtataa

DBGET integrated database retrieval system