KEGG   Bacillus cereus ATCC 14579: BC0026Help
Entry
BC0026            CDS       T00127                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bce03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
27447..28043
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVC
GHITDRDPCYICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMEGIGPE
DINIPQLLKRLHDETVQEVILATNPNIEGEATAMYISRLLKPTGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaaccaatatcaaaactaatcgatagttttatgaagttgccaggtatc
ggaccgaaaacagcggttcgattggcatttttcgtattagatatgaaagaagatgatgtg
ttaggtttcgcgaaagcacttgtaaatgcgaagcgagatttagcgtactgttctgtatgc
ggacatattactgatcgtgatccttgttatatttgtaatgattcacatcgagatcaatca
gttgtttgtgtcgtgcaagaaccgaaagatgtaatcgcgatggaaaaaatgaaagagtat
caaggtgtatatcatgtgttacgtggtgcgatttctcctatggagggaattggaccggaa
gacattaatatcccgcaactcttaaagcgactacatgatgaaacggtacaagaagtgata
ttagcaacaaaccctaatattgaaggggaagctacagcgatgtatatctcccgcctctta
aaacctacaggcattaaagtaactcgtattgcacatggtctgccagttggtggagattta
gaatatgcagatgaagtgacattatccaaagcgttagaagggcgcagagaagtataa

DBGET integrated database retrieval system