KEGG   Bacillus cereus ATCC 14579: BC0185Help
Entry
BC0185            CDS       T00127                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bce01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bce00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
158260..159153
Genome map
AA seq 297 aa AA seqDB search
MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVKDMGDICIEREKEIDE
NTKLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGTLAGVAKHYKNLGVIWY
DAHGDLNTEETSPSGNIHGMSLAASLGYGHSSLVDLYGAYPKVKKENVVIIGARALDEGE
KDFIRNEGIKVFSMHEIDRMGMTAVMEETIAYLSHTDGVHLSLDLDGLDPHDAPGVGTPV
IGGLSYRESHLAMEMLAEADIITSAEFVEVNTILDERNRTATTAVALMGSLFGEKLK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaatctcagttattggagttccaatggatttaggacagatgcgtcgtgga
gttgatatgggaccgagcgcgatccgttatgcaggggtaattgaaagaattgaagaaatt
ggatatgacgttaaagatatgggagatatatgtatagagagagaaaaagagatagatgaa
aatacaaaattaagaaaccttacacaagttgcaactgtatgtaatgaattagcaagtaag
gtggatcatattatagaagaaggtcgttttccacttgtattaggtggtgaccatagtatt
gctatcggtacattagctggtgtagcaaaacattataaaaacttaggcgttatttggtat
gatgcacacggtgatttaaatacagaggaaacttcaccatctggaaatattcatggtatg
tcacttgcagcaagtttaggttatggacattcttcacttgtagatttatacggagcatat
ccaaaggtgaaaaaagagaatgtcgtaattatcggtgcgcgtgcattggatgaaggagaa
aaagatttcattcgcaatgaaggtattaaagtgttctcaatgcatgaaattgatcgtatg
gggatgacggctgtgatggaagaaacaatcgcatatttatctcataccgatggtgtacac
ttatcattagatttagatggtcttgatcctcatgatgcaccaggtgttggaacgcctgta
attggcggtctatcttatcgtgaaagtcatttggcgatggaaatgttagcagaagctgat
attatcacatctgctgaatttgttgaggtaaatacgattttagatgagagaaatagaacg
gcaacaacagcagttgctttaatgggttctttattcggtgaaaaactaaaataa

DBGET integrated database retrieval system