KEGG   Bacillus cereus ATCC 14579: BC0244Help
Entry
BC0244            CDS       T00127                                 

Definition
(RefSeq) oligopeptide transport ATP-binding protein oppD
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce02024  Quorum sensing
Module
bce_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:bce00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BC0244
Transporters [BR:bce02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    BC0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_21 IstB_IS21 ATP-synt_ab AAA_16 NACHT AAA_25 TniB RsgA_GTPase Sigma54_activat
Motif
Other DBs
NCBI-GeneID: 1202597
NCBI-ProteinID: NP_830112
UniProt: Q81IV2
Position
219960..220940
Genome map
AA seq 326 aa AA seqDB search
MSKAVVELKDLQTHFQTEEGTVKAVNHVSFSVREGETVCVVGESGCGKSVTALSIMGLIA
ESGSVVGGDILYEGKSLLGMKEKELRSLRGNDIAMIFQEPMTSLNPVFTVGEQIVETLRE
HELLSKNEAYKKAIELIRKVGIARADEIVHSYPHELSGGMLQRIMIAVALSCNPKLLIAD
EPTTALDVTIQAQILDLLRQVKEEFKTSILLITHDLGVVAEMADYVVVMYGGKVIEEAPV
LEIFQNPKHPYTKGLLKSKPVMGKRIDKLYSIPGQVPNLVGLGEFCYFSGRCEHCMEICE
KEAPNLNVNDENHKVACWLYEERAEQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcggtagtagagctgaaagatttacaaacacactttcagacagaagaaggg
acagtaaaagctgtgaatcatgttagtttttctgttcgagaaggtgaaactgtttgtgtt
gtaggtgaatctggttgcggaaaaagtgtaacggcgttatctattatgggacttattgct
gaatcaggcagtgtagtaggtggagatattttatatgaaggaaaaagtcttttaggaatg
aaagagaaagagcttcgtagtttacgagggaatgatattgcgatgattttccaagaaccg
atgacatcgctaaaccccgtcttcactgtaggagagcaaattgtagaaacgttaagggag
catgaattacttagtaaaaatgaagcatataagaaggcaattgagttaattcgtaaagtt
ggcatagcccgcgctgatgaaatcgtccattcttatccgcatgaactgagcggcgggatg
ttacaacgtattatgattgctgttgcacttagttgtaatcctaagttattaattgcggat
gaaccaacaacagctcttgatgttaccattcaggctcaaatattggatctactaagacaa
gtgaaagaagaatttaaaacgtcgattttattaattacacatgacttaggtgtcgtagcg
gaaatggctgattatgttgtcgttatgtatggcgggaaagttatcgaagaagccccagta
ctagagatattccaaaatccaaaacatccttatacgaaaggattattgaaatcaaaacca
gtaatgggaaaacgaatagataaactatattctattccagggcaagttccgaatttagtt
ggtttaggtgagttttgctactttagtgggcgttgtgagcattgtatggaaatatgtgaa
aaagaagccccaaatctaaatgtaaatgatgaaaatcataaagtagcttgctggttatat
gaggagcgtgcggaacaatga

DBGET integrated database retrieval system