KEGG   Bacillus cereus ATCC 14579: BC0251Help
Entry
BC0251            CDS       T00127                                 

Definition
(RefSeq) hypothetical protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3948
Motif
Other DBs
NCBI-GeneID: 1202604
NCBI-ProteinID: NP_830119
UniProt: Q81IU7
Position
223846..223965
Genome map
AA seq 39 aa AA seqDB search
MRDMNSEQVFQVTKTDLLGSLGGAVILTSVILFLANVLV
NT seq 120 nt NT seq  +upstreamnt  +downstreamnt
atgagggatatgaacagtgaacaagtgtttcaagtaacaaaaacagatttattaggatcc
ttaggtggagcggtaatattaacatcagttattctattccttgcaaatgtattagtatga

DBGET integrated database retrieval system