KEGG   Bacillus cereus ATCC 14579: BC0265Help
Entry
BC0265            CDS       T00127                                 

Definition
(RefSeq) hypothetical protein
  KO
K07723  CopG family transcriptional regulator / antitoxin EndoAI
Organism
bce  Bacillus cereus ATCC 14579
Brite
Transcription factors [BR:bce03000]
 Prokaryotic Type
  Ribbon-helix-helix
   CopG family
    BC0265
Prokaryotic defense system [BR:bce02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   MazF-MazE
    BC0265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALP
Motif
Other DBs
NCBI-GeneID: 1202618
NCBI-ProteinID: NP_830133
UniProt: Q814B2
Position
240105..240392
Genome map
AA seq 95 aa AA seqDB search
MSESSVTTEIVVRLPKQMVTELDGIGKQENKNRHELICQATQLLLRQHKTKKRYQHESMR
RGYIEMGKINLGIASEAFLAEYEAAHTVERLVSGG
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaatcaagtgtaactactgaaatcgtggttcggttgccaaagcaaatggtaacg
gaattggacggaattggaaaacaagagaataagaatcgccatgaactaatttgccaggca
acacaattgttattgcgtcaacataagacgaagaaacgctaccaacatgaatcaatgcga
cgtgggtacattgaaatgggaaaaattaatcttggtattgcatctgaagctttcttagca
gagtatgaagcagctcatacagtagaacgcttagttagcggggggtaa

DBGET integrated database retrieval system