KEGG   Bacillus cereus ATCC 14579: BC0286Help
Entry
BC0286            CDS       T00127                                 

Definition
(RefSeq) ATP/GTP hydrolase
  KO
K06925  tRNA threonylcarbamoyladenosine biosynthesis protein TsaE
Organism
bce  Bacillus cereus ATCC 14579
Brite
Transfer RNA biogenesis [BR:bce03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BC0286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TsaE dNK AAA_18 AAA_33 NACHT AAA_25 T2SSE RsgA_GTPase RuvB_N Viral_helicase1 MoCF_biosynth
Motif
Other DBs
NCBI-GeneID: 1202639
NCBI-ProteinID: NP_830137
UniProt: Q81IT1
Position
250304..250777
Genome map
AA seq 157 aa AA seqDB search
MSKYEVTTKSSEETQRLSEKLGELVEAQDVIILEGDLGAGKTTFTKGLAKGLGVKRVVNS
PTFNIIKEYKGRLPLYHMDVYRLAESEEDLGFDEYFYGEGITVVEWAHLIEAYLPNEKLQ
ISLFHAGDDTRKIILEPIGDRYIRLCEELLQDESTSN
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaatatgaagtaacaacaaaatcttctgaggaaacacaaaggttatcagaaaaa
ctaggtgagctcgtagaggcacaagacgtaattattttagaaggagatcttggagctggt
aagacgacttttacaaagggactagcaaaaggtcttggagtgaaaagagttgtaaatagt
cctacctttaatatcatcaaagaatataaaggaagattaccgctatatcatatggacgtg
tatcgcttagcagaaagtgaagaggacttaggctttgatgaatatttctacggtgaagga
attacggtagtagaatgggctcatttaatagaagcatatttaccgaatgaaaagttacaa
attagtttattccatgctggagatgacacaagaaaaattatactcgagccaattggagat
cgctatattagattatgtgaggagctattacaagatgaaagtactagcaattga

DBGET integrated database retrieval system