KEGG   Bacillus cereus ATCC 14579: BC0288Help
Entry
BC0288            CDS       T00127                                 

Definition
(RefSeq) ribosomal-protein-alanine acetyltransferase
  KO
K03789  [ribosomal protein S18]-alanine N-acetyltransferase [EC:2.3.1.266]
Organism
bce  Bacillus cereus ATCC 14579
Brite
Enzymes [BR:bce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.266  [ribosomal protein S18]-alanine N-acetyltransferase
     BC0288
Ribosome biogenesis [BR:bce03009]
 Prokaryotic Type
  ribosomal protein modification factors
   BC0288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_4 Acetyltransf_3 Acetyltransf_6 FR47 Acetyltransf_9 Acetyltransf_8 GNAT_acetyltran Acetyltransf_CG ZnuA
Motif
Other DBs
NCBI-GeneID: 1202641
NCBI-ProteinID: NP_830139
UniProt: Q81IS9
Position
251485..251907
Genome map
AA seq 140 aa AA seqDB search
MELDDIAQIVAIEEASFSTPWTADAFHRELTMNEHAHYIVLEKDGRVVGYCGLWIIIDES
HITNIAILPEYRGQKLGDALLKAVISEAKELGVKTMTLEVRVSNEVAKQLYRKYGFQNGG
IRKRYYADNQEDGLVMWVNI
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggagcttgatgatattgctcaaattgtagctattgaagaagcgtctttttcaactcct
tggactgcagatgcctttcaccgtgaattaacgatgaatgaacatgcacattatattgtg
ttagaaaaagatggtcgtgtagtcgggtattgtggattgtggataattattgatgaatca
catataacaaatatagctattttgccagaataccgaggtcaaaagttaggagatgcccta
ttgaaagcagttatttctgaagcgaaagaactaggggtaaaaacaatgacacttgaagta
cgtgtatcaaatgaagtagcaaagcagttatacagaaaatacggatttcaaaatggtggg
attcgtaaacgatactatgcagacaatcaggaagatggtctcgtaatgtgggtgaatata
taa

DBGET integrated database retrieval system