KEGG   Bacillus cereus ATCC 14579: BC0290Help
Entry
BC0290            CDS       T00127                                 

Definition
(RefSeq) ABC transporter ATP-binding protein uup
  KO
K06158  ATP-binding cassette, subfamily F, member 3
Organism
bce  Bacillus cereus ATCC 14579
Brite
Translation factors [BR:bce03012]
 Eukaryotic Type
  Initiation factors
   Initiation associated factors
    BC0290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_tran_Xtn AAA_21 ABC_tran_CTD SMC_N AAA_22 AAA_29 MMR_HSR1 NB-ARC RsgA_GTPase NACHT AAA TsaE AAA_33 RNA_helicase AAA_16 AAA_30 NTPase_1 AAA_24 Roc DUF815 AAA_25 ArgK RuvB_N AAA_14 AAA_28 Zeta_toxin ATPase_2 Dynamin_N AAA_15 AAA_7
Motif
Other DBs
NCBI-GeneID: 1202643
NCBI-ProteinID: NP_830141
UniProt: Q81IS7
Position
complement(253404..255338)
Genome map
AA seq 644 aa AA seqDB search
MKTLILLQVNALSKLYGAETILANIKLEVQTKDRIALVGRNGAGKSTLLKIIAGELSHDG
GEIIKPKDVSIGYLAQNTGLETSLTIWDEMLTVFTHLQQMETKLRRLEQEMGKEKNFSNE
ATYERLLADYDQLQLNYKDQGGYQYEADIRSILSGLGFPVETHQTTISTLSGGQKTRLAL
GKLLLTKPDLLILDEPTNHLDIETLTWLEQYLQGYPGAILIVSHDRYFLDKLVTQVYEIS
NKESRRFVGNYSKYLDLKSALYEQEMKRYEKQQDEIAKLEDFVQKNIARASTTKRAQSRR
KQLDRMELLTRPLGDSKSASFHFDIEKQSGNDVLQVNDATIGYDGNPIIEHVTMRLTRGD
SVALVGPNGIGKSTLLKSIVNKLPLLNGDVSFGSNVSVGYYDQEQANLTSSKRVLNELWD
EYPLQPEKEIRTILGNFLFTGDDVLKPVSSLSGGQKARLALAKLMMQKSNLLILDEPTNH
LDLNSKEILENALIDYPGTLLFVSHDRYFINRVTTTVVELSTEGAQEYLGDYDYYVEKKN
EMIERAELEQQESDVPVQKVVAQEKLNYLEEKERKKLERQRTRKIEELEQSIVELEEEIA
TLEDQLCLPEIYADYEKASEITTKKQTLQEQLETCMAEWEELHV
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacattgattttattacaagtaaacgcgctttcgaaattatacggtgcagaaacg
attcttgcaaacataaaattggaagtacaaacaaaagatcgtatcgcattagttggaagg
aatggagcaggaaaatctacattattaaaaattatcgctggtgaattatctcatgatggt
ggcgaaattataaaaccgaaagatgtctcaatcggatatttagctcaaaatactggacta
gaaacgtctttaacaatttgggatgaaatgctaaccgtctttacccacttacagcaaatg
gagacaaaacttcgaaggcttgagcaagaaatgggaaaagaaaaaaacttttcaaacgaa
gctacatatgaaagattgttagctgattatgaccaactacaactcaattataaagatcaa
ggtggatatcaatatgaagcggatattcgctccattttaagcggccttggcttcccagtt
gaaacgcaccagacgacgatctctactttaagcggcgggcaaaaaacaagattagctctc
gggaaattattattaacaaaaccagacttacttattttggacgagcctacaaaccattta
gacatcgaaacattaacatggcttgagcaatatttgcaaggttatcctggcgcaatatta
atcgtctcacatgaccgttatttcttagacaaactcgttacacaagtatatgaaatttcg
aataaagaaagcagacgatttgttggtaactacagtaaatatttagacttaaaatcagca
ttatatgagcaagaaatgaaacgttacgaaaaacaacaagatgaaatcgcaaaacttgag
gacttcgttcaaaagaatatagctcgcgcttctacaacgaaacgtgctcaaagtcgccgt
aaacaactagacagaatggaattattaacgagaccattaggggattctaagtcagcatca
ttccacttcgatattgaaaaacaaagtggaaatgatgttttacaagtaaatgatgcaacc
atcggctatgatggaaaccctataattgaacatgtaactatgcgcttaactcgcggagat
agtgttgctttagttggtccaaacggaattgggaaatccacattgttaaaatccattgtg
aataagttaccactattaaatggtgatgtttctttcggatcaaatgtatctgttggttat
tatgatcaagaacaagcaaacttaacatcttctaaacgggttttaaatgaactatgggat
gaatatccactgcaaccggaaaaagaaatccgtactatacttgggaattttttattcaca
ggagatgatgtactgaaaccagtatcttcccttagtggtggacaaaaagctcgattagct
cttgcaaaacttatgatgcaaaagtcaaatttgttaattctagatgagcctacgaaccac
cttgatttaaatagtaaagagattttggagaatgctttaattgattacccagggactctt
ctattcgtctcacatgaccgctactttattaaccgtgtaacaacgactgtggttgagtta
tcaacagaaggtgcacaggaatatttaggggattacgattactacgttgaaaagaaaaat
gaaatgattgaacgtgcagaacttgaacagcaagaaagtgacgttcctgttcaaaaggtg
gttgcacaagagaaattaaattatttagaagaaaaagagcgtaaaaaactagagcgtcaa
cgcactagaaaaattgaagagctagaacaaagtatagtggaattagaagaagaaattgct
acgttagaagatcaactttgcttaccagaaatatatgcagattatgaaaaagctagtgaa
attacaactaaaaagcaaacgctacaagaacaacttgaaacttgtatggcagaatgggaa
gagctgcatgtataa

DBGET integrated database retrieval system