KEGG   Bacillus cereus ATCC 14579: BC0291Help
Entry
BC0291            CDS       T00127                                 

Definition
(RefSeq) redox-sensing transcriptional repressor Rex
  KO
K01926  redox-sensing transcriptional repressor
Organism
bce  Bacillus cereus ATCC 14579
Brite
Transcription factors [BR:bce03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    BC0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Put_DNA-bind_N HTH_DeoR GFO_IDH_MocA HTH_11 TylF Semialdhyde_dh F420_oxidored
Motif
Other DBs
NCBI-GeneID: 1202644
NCBI-ProteinID: NP_830142
UniProt: Q81IS6
Position
255517..256146
Genome map
AA seq 209 aa AA seqDB search
MDQQKIPQATAKRLPLYYRFIQNLSLSGKQRVSSAELSEAVKVDSATIRRDFSYFGALGK
KGYGYNVNYLLSFFRETLDQDDITRVALIGVGNLGTAFLHYNFTKNNNTKIEMAFDVSEE
KVGTEIGGIPVYHLDELEERLSNDIQVAILTVPATVAQAVADRLAETSVHGILNFTPARL
NVSENIRIHHIDLAVELQTLVYFLKNYPQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggatcagcaaaagattccacaagccactgctaaaagattgcctctatactatcgattt
atccaaaacttatctctttctggtaagcagcgtgtttcatcggccgaattgagtgaggca
gtaaaagtagattccgcaacaatacgaagagatttttcgtattttggagcgttagggaaa
aagggatatggatataacgtaaattatttattatcatttttccgcgaaacacttgatcaa
gatgatataacacgtgtagcacttattggagtaggtaatttagggaccgctttcttacat
tataatttcacgaaaaacaataatacaaaaattgaaatggcatttgatgttagtgaagag
aaagttggaacagaaatcgggggcattcctgtatatcatttagatgaattagaagagaga
ttatcaaatgatatacaagtggcaatattaacagtaccggctacagtagcacaagctgta
gcagatagattagctgaaacaagcgtgcacggtattttgaatttcacaccagcgcgatta
aacgtatcagagaatattagaattcatcatattgacttagctgtagagttacaaacatta
gtttactttttgaaaaactatccacaataa

DBGET integrated database retrieval system