KEGG   Bacillus cereus ATCC 14579: BC0319Help
Entry
BC0319            CDS       T00127                                 

Definition
(RefSeq) hypothetical protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulfotransfer_2
Motif
Other DBs
NCBI-GeneID: 1202672
NCBI-ProteinID: NP_830161
UniProt: Q81IR0
Position
complement(292315..293106)
Genome map
AA seq 263 aa AA seqDB search
MFNPSLLHIISSHSRSPHYHRKFPIILFWSQKSGCTSLAKWFFYQIDLLQTALSYSPFIH
NYEYDIYKSTPAYSVRLGVALREKQKETFKLVRNPYRRAVSSFVSLIGPPYMENPEWKPI
RKFLYQDENSTKGISFKQFLYYLFIKGAHASDINPHFTQQYIAGEEEYVTNYIYLENFDH
EMKELEKRFELKTAPINEFSTSWHHQTPAMIYKGNFSEGDITDPLFPRHPTFESFYDTEC
IQLVQTIFQNDFDTYKYSKEYPY
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
ttgttcaatccttctttattacacatcataagctcccattcaagaagcccacactatcat
aggaagtttccaatcattctattttggagtcaaaaaagcggctgtacttctcttgctaag
tggttcttttaccagattgatttattacaaaccgctctaagctatagtcctttcattcat
aattatgaatatgatatatacaaaagtacacctgcctatagtgtacgactaggagtagcg
ttacgagaaaaacaaaaagaaacttttaaacttgttcgtaacccttataggagagcagtc
agttctttcgtgtccttaattggacctccttatatggaaaatcccgaatggaaacccatc
cgaaagtttttatatcaagatgaaaattccaccaaagggatctcatttaaacaattttta
tactatctatttataaaaggggctcacgcaagtgatattaacccacatttcacacaacaa
tatatagctggtgaagaagaatatgtgaccaattatatatacttagaaaacttcgatcac
gaaatgaaagaattagaaaagcgtttcgaattaaaaaccgcaccaataaatgagttctca
acatcatggcatcatcaaactcccgccatgatttataaagggaattttagcgaaggcgat
attactgatcctttatttccacgtcatccaacttttgaaagcttttatgatactgaatgt
atacaacttgtccaaacaatatttcaaaatgatttcgacacatataaatacagcaaagaa
tatccatactaa

DBGET integrated database retrieval system