KEGG   Bacillus cereus ATCC 14579: BC0324Help
Entry
BC0324            CDS       T00127                                 

Definition
(RefSeq) 5-(carboxyamino)imidazole ribonucleotide synthase
  KO
K01589  5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00230  Purine metabolism
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01130  Biosynthesis of antibiotics
Module
bce_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BC0324
Enzymes [BR:bce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.18  5-(carboxyamino)imidazole ribonucleotide synthase
     BC0324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp 2-Hacid_dh_C Dala_Dala_lig_C NAD_binding_2 ATPgrasp_Ter GARS_A F420_oxidored 3HCDH_N NAD_binding_7 XdhC_C Pyr_redox
Motif
Other DBs
NCBI-GeneID: 1202677
NCBI-ProteinID: NP_830163
UniProt: Q81IQ8
Position
299468..300619
Genome map
AA seq 383 aa AA seqDB search
MTRIILPGKTIGIIGGGQLGRMMALAAKEMGYKIAVLDPTKHSPCAQVADIEIVAPYDDL
KAIQHLAEISDVVTYEFENIDYRCLQWLEKHAYLPQGSQLLNTTQNRFTEKNAIEKAGLP
VATYRLVQNQDQLTEAIAGLSFPSVLKTTTGGYDGKGQVVLRSEADVEAARNLVDKAECI
LEKWVPFEKEVSVIVIRSVSGETKVFPVAENIHVNNILHESIVPARITEELSQKAIAYAK
VLADELELVGTLAVEMFATDNVEIYINELAPRPHNSGHYTQDACETSQFGQHIRAICNLP
LGETNLLKPVVMVNILGEHIEGVLRQVNRLTGCYLHLYGKEEAKAQRKMGHVNILNDNIE
VALEKAKSLHIWDHQEQLLEGKR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgacgagaatcattttacctggaaaaacaatcggtattattggaggcggccagctagga
agaatgatggcattggcagctaaggagatgggatataaaattgctgttttagatcctaca
aagcattcgccatgtgcacaagttgctgatattgaaattgttgcaccatatgatgattta
aaagcaattcagcatttagcagagataagtgatgttgtcacatatgaatttgagaatatt
gattatagatgtttacaatggcttgaaaaacatgcgtacttaccacaaggtagtcagttg
ttaaatacaacacaaaatcgttttacagaaaagaatgcgattgagaaggctgggttacca
gtagcaacgtatagattagttcaaaatcaagatcagcttacagaagcaattgctgggtta
tcattcccttccgtcttaaaaacgacgacaggtggatatgatgggaaaggacaagttgtt
ttaagaagtgaagctgatgttgaggcagcaagaaatcttgtggataaagcagaatgtatt
ttagagaaatgggtgccttttgaaaaagaagtatcagttattgtgattcgtagtgtaagt
ggtgaaacaaaagtgtttccagtagcagaaaatattcatgtaaataacattttacatgaa
tctatcgttccagctcgcattacagaagagctttctcaaaaagcaattgcgtatgcaaag
gtacttgcggatgaattagaacttgtgggaacactagctgtagagatgtttgctacagat
aatgttgagatttatattaatgaattagcgccaagacctcacaattcaggacactataca
caggatgcatgtgaaacgagtcaatttggtcaacatattcgagcaatctgtaatttacct
ctaggagaaacaaatttgttaaaaccagttgtcatggtaaacattttaggcgaacatata
gaaggggtcctaagacaagtgaatagattaaccgggtgctatttacacttgtatggaaaa
gaagaagcaaaagcacagcgaaaaatggggcatgttaatattttaaatgataatattgaa
gtcgctctagaaaaagcgaagagtttgcatatttgggaccatcaagaacaactgttggag
ggaaaaagatga

DBGET integrated database retrieval system