KEGG   Bacillus cereus ATCC 14579: BC0326Help
Entry
BC0326            CDS       T00127                                 

Definition
(RefSeq) phosphoribosylaminoimidazole-succinocarboxamide synthase
  KO
K01923  phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00230  Purine metabolism
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01130  Biosynthesis of antibiotics
Module
bce_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BC0326
Enzymes [BR:bce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     BC0326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SAICAR_synt
Motif
Other DBs
NCBI-GeneID: 1202679
NCBI-ProteinID: NP_830165
UniProt: Q81IQ6
Position
302012..302731
Genome map
AA seq 239 aa AA seqDB search
MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITGKGRLNNEITTLLFRK
LQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTVLAEPIVEF
YFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLIDHFASCRVRLVDFKLEF
GVTEEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTDAYEEILKRLGGISHV
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagctagaattgctgtatgaaggtaaggcaaaaagaatttatcgtacagaatca
gcagatatggtttgggtagagtacaaagatagtgcgactgctttcaatggggagaaaaaa
gagacgattacaggaaaaggtcgtttgaacaatgaaattacaactttattgttcagaaag
ttacaagaagtgggaattaaaacacattttgttgagaagttatctgaaacagaacaactt
gttaaaaaagtgagtattattcctttagaagttgtcacaagaaatgtaattgcaggaagt
ctttcaaaacgattaggaatggaagagggaactgtacttgcagaaccaatcgtagaattt
tacttcaaagatgatgatttaggagatccgcttgtaacggaagatcatattcgtgtatta
aacgttgcatcgccagagcaagtaagtgtattacgagatatggctctacaaatcaatcaa
gtgttgattgatcatttcgcaagctgtcgtgtaagattagtagatttcaaattagagttt
ggtgtaacggaagaaggagaaatcattttagcggatgaaatttcaccagatacttgccgt
ttatgggatgaaacgagcaatgaaaagtttgataaagacgtattccgtcgtgatcttgga
aatttaacagatgcttatgaagagattttaaaacgtttagggggaatttcacatgtataa

DBGET integrated database retrieval system