KEGG   Bacillus cereus ATCC 14579: BC0328Help
Entry
BC0328            CDS       T00127                                 

Definition
phosphoribosylformylglycinamidine synthase I (EC:6.3.5.3)
Orthology
K01952  
phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bce00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
302975..303658
Genome map
AA seq 227 aa AA seqDB search
MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCG
AISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALIRNENLKFMCRTVQLRVE
NNETMFTSQYEKDEIINIPIAHGEGNYYCDEATLKQLEENNQIAFRYVENPNGSVSDIAG
IVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRETYVVNA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatttgccgtaatagtatttccgggttcgaactgtgatgtcgatatgttccatgca
attaaagatgagcttggcgaagaagtagattacgtttggcacgatacagagaatttagat
gaatatgatgcaattctactaccaggtggattttcttatggtgactacttacgctgcggt
gctatctctcgctttgctaatgcaatgaaagcagtgcaaaaagctgctgagcaaggaaag
ccgattttaggtgtatgtaatggattccagattcttgttgaatcaggattactaccagga
gcgttaataagaaacgaaaacttaaaatttatgtgtcgcactgttcagttacgtgttgaa
aataatgaaacgatgtttacatcacaatatgaaaaagatgaaataattaatattccaatc
gcgcatggtgaggggaattactattgtgatgaagcgactcttaaacaattagaagagaac
aatcaaatcgcattccgttatgtagaaaaccctaacggtagcgtttcagatattgctggt
attgtaaatgaaaaaggaaatgtacttggtatgatgccgcacccagagcgtgctgtagat
gaattacttggcggtgctgaagggttaaaagtctttcaatctatcttaaaacagtggagg
gaaacatatgtcgttaatgcttga

DBGET integrated database retrieval system