KEGG   Bacillus cereus ATCC 14579: BC0365Help
Entry
BC0365            CDS       T00127                                 

Definition
(RefSeq) nitrogen regulation protein NIFR3
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dus
Motif
Other DBs
NCBI-GeneID: 1202718
NCBI-ProteinID: NP_830204
UniProt: Q81IM0
Position
345506..346495
Genome map
AA seq 329 aa AA seqDB search
MIDNFWRELPRPFFVLAPMEDVTDVVFRHVVSEAGRPDVFFTEFTNSDSYCHPEGMKSVR
GRLIFTEDEQPMVAHIWGDNPEYFRQMSIGMAELGFKGIDINMGCPVPNVASRGKGSGLI
LRPDVAAELIQAAKAGGLPVSVKTRLGFKELSEWEDWLTHIFKQDIANLSIHLRTREEMS
QVDAHWELIPEIKKLRDRIAPNTLITINGDILDRKMGLELAEKYGIDGVMIGRGIFKNPF
AFEKEPREHSSKEHLDLLRLQLDLQDQYAEVLPRSITGLHRFFKIYVKGFPGAAELRNQL
MSTKSTDEVRALLDKFEASVDEAQDSETV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgatagataatttttggcgtgaattaccacgaccatttttcgtacttgcaccaatggaa
gatgtgacagacgttgttttccgtcacgtagtaagtgaagcaggtcgtccggacgtattc
ttcacagagtttacaaactcggatagctattgtcatccagaaggtatgaaaagtgtacgt
ggccgtttaatttttacagaagacgaacagccgatggtggcacatatttggggagacaat
cccgaatacttccgtcaaatgagtattggtatggcagaactaggatttaaaggcatcgat
attaacatgggttgcccagtaccgaacgttgcatcaagaggaaaaggtagtggccttatt
ctacgtccagacgttgcggcagaacttatccaagcagcaaaagcgggcggactacctgtc
agcgtaaaaacacgacttggctttaaagagttaagcgagtgggaagattggttaacgcac
attttcaaacaagatattgcaaacctttctattcacttacgtacaagagaagaaatgagc
caagtagatgcgcattgggaactaattccggaaattaaaaaattacgtgaccgtatcgca
ccaaatacgttaataacaatcaatggagacatccttgatcgtaaaatggggctggaactt
gctgaaaaatacggcattgatggcgtaatgatcgggcgaggcatcttcaaaaatccattt
gcgtttgaaaaagagccaagagagcatagcagtaaagaacatctagatcttttaagacta
cagctggatttacaagatcaatatgcagaagtactgccacgctcaatcacagggcttcac
cgcttcttcaaaatttatgtaaaaggcttccctggagctgctgaattgagaaatcaattg
atgagcacgaagtcaacggatgaagtacgtgcattgcttgataagtttgaggcgagtgtt
gatgaggctcaggatagtgagacggtttaa

DBGET integrated database retrieval system