KEGG   Bacillus cereus ATCC 14579: BC0380Help
Entry
BC0380            CDS       T00127                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bce00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
362532..363173
Genome map
AA seq 213 aa AA seqDB search
MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPSGLEYYETKPEDVVIL
NLDGEVVEGERKPSSELDMHLIYYRKREDINALVHTHSPYAKTIASLGWELPAVSYLIAF
AGPNVRCAPYETFGTKQLAEAAFEGMIDRRAVLLANHGLIAGANNIKMAFTVAEEIEFCA
QIYYQTKSIGEPKLLPEDEMENLAKKFEGYGQQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttattacaaaaagaaagagaagaaattgtagcgtatggaaagaaaatgatttctagt
ggtttaacaaagggaacgggcggtaatattagtatctttaatcgtgaacaaggtcttgtt
gcgattagcccaagtggtttagagtattatgaaacaaagcctgaagatgtagttatatta
aacctagatggtgaagtagtagaaggagagagaaaaccatcaagtgaattagatatgcac
cttatttactataggaagcgtgaagatataaatgcgcttgtgcatacacactctccttac
gcgaagacgattgcatcattaggatgggagcttcctgctgtatcgtatttaattgctttc
gcaggaccgaatgtgcgctgtgcaccgtatgaaacatttggtacgaagcaattagcggag
gctgcttttgaaggcatgattgatcgccgtgctgttttacttgcaaatcacggtttaatt
gctggtgcaaataatataaaaatggcgtttactgttgcagaagagattgagttttgtgct
caaatttattatcaaacgaaaagcattggggaaccaaagctattgccagaagatgagatg
gagaatttggcgaagaagtttgaagggtatgggcagcagtag

DBGET integrated database retrieval system