KEGG   Bacillus cereus ATCC 14579: BC0380Help
Entry
BC0380            CDS       T00127                                 

Definition
(RefSeq) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00051  Fructose and mannose metabolism
bce01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BC0380
Enzymes [BR:bce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BC0380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-GeneID: 1202733
NCBI-ProteinID: NP_830219
UniProt: Q81IK6
Position
362532..363173
Genome map
AA seq 213 aa AA seqDB search
MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPSGLEYYETKPEDVVIL
NLDGEVVEGERKPSSELDMHLIYYRKREDINALVHTHSPYAKTIASLGWELPAVSYLIAF
AGPNVRCAPYETFGTKQLAEAAFEGMIDRRAVLLANHGLIAGANNIKMAFTVAEEIEFCA
QIYYQTKSIGEPKLLPEDEMENLAKKFEGYGQQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttattacaaaaagaaagagaagaaattgtagcgtatggaaagaaaatgatttctagt
ggtttaacaaagggaacgggcggtaatattagtatctttaatcgtgaacaaggtcttgtt
gcgattagcccaagtggtttagagtattatgaaacaaagcctgaagatgtagttatatta
aacctagatggtgaagtagtagaaggagagagaaaaccatcaagtgaattagatatgcac
cttatttactataggaagcgtgaagatataaatgcgcttgtgcatacacactctccttac
gcgaagacgattgcatcattaggatgggagcttcctgctgtatcgtatttaattgctttc
gcaggaccgaatgtgcgctgtgcaccgtatgaaacatttggtacgaagcaattagcggag
gctgcttttgaaggcatgattgatcgccgtgctgttttacttgcaaatcacggtttaatt
gctggtgcaaataatataaaaatggcgtttactgttgcagaagagattgagttttgtgct
caaatttattatcaaacgaaaagcattggggaaccaaagctattgccagaagatgagatg
gagaatttggcgaagaagtttgaagggtatgggcagcagtag

DBGET integrated database retrieval system