KEGG   Bacillus cereus ATCC 14579: BC0441Help
Entry
BC0441            CDS       T00127                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC0441
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC0441
   00052 Galactose metabolism
    BC0441
   00500 Starch and sucrose metabolism
    BC0441
   00520 Amino sugar and nucleotide sugar metabolism
    BC0441
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BC0441
   00524 Butirosin and neomycin biosynthesis
    BC0441
Enzymes [BR:bce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BC0441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
429759..430637
Genome map
AA seq 292 aa AA seqDB search
MKEYIAFDIGGTQIKYGIVSEIGRVLKRQTVATEIHLGGEQIIQKLIYVSKKIMNEHTIT
GIGISTAGIVDINKGIVTGGADHIPGYSTIPIIDRLQEILKVPVSIDNDVNCAAFGEKWN
GSGREKDNFIMLTLGTGIGGAIFIDGKLYRGHSFSAGEWGNMLIEEKTFEEVASISGLIR
LVSKYKGKGKWNGKRIFELYDKGDREVAQAVGIFFKHLAIGISNLAYIFNPETIIIGGGI
TDRGNEFLKEVKEEVSKYLNQEIYNNCEIELAQNGNCAGMIGAIYHFLHHHK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagtatatagcgtttgatattggcggtacgcaaattaagtatggtattgtttca
gaaatagggagagtattaaagcgtcaaacagttgcaacagaaattcatttaggcggagaa
caaattattcaaaaacttatatatgtatccaaaaaaataatgaatgaacatactattacc
ggaatcggtattagcactgcgggaattgttgatattaataaaggaattgtgacgggaggt
gcggatcatattccgggatatagtactattcctattattgatagattgcaagagatatta
aaagttccagtatcgattgacaatgatgtgaattgtgcagcgtttggagaaaagtggaat
ggtagtggaagagagaaagataactttattatgctcacccttggaacagggattggggga
gcaatttttatagatggaaaattgtaccgaggacattcatttagtgctggtgaatggggg
aatatgttaatagaagaaaaaacgtttgaagaggttgcttcgatttcaggattaattcga
cttgtaagcaaatataaaggcaaaggcaagtggaatgggaaaagaattttcgagttgtat
gataaaggagatcgggaagttgctcaagcagttgggattttctttaaacatttggcaatc
ggaattagtaatcttgcttatatttttaatccagaaacgattattattggtggaggaatt
accgatagaggaaatgagtttttaaaagaagtaaaagaagaggtcagtaaatacttaaat
caagagatttataataattgtgagattgaacttgcgcaaaacggtaattgtgcaggaatg
attggtgctatttaccacttcttacatcatcataagtaa

DBGET integrated database retrieval system