KEGG   Bacillus cereus ATCC 14579: BC0660Help
Entry
BC0660            CDS       T00127                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BC0660
Enzymes [BR:bce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BC0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
656644..657540
Genome map
AA seq 298 aa AA seqDB search
MPNIAVVGSISMDLVAVSKKRPKAGETVIGEAFHTIPGGKGANQAVAAARLGANVAMVGA
VGNDDYGTVVRKNLENERIFIDYVVPVTDRTTGIAHIVLAEEDNSIVVVQGANALVNKSV
VDRSKDLLVKADMVVLQLEIPLETVKYVLAICEEHNIPVMLNPAPAQVLSEEILEKATYI
TPNEHECRIVLDDFTSPIEDLLAKYPNKLLMTEGSNGVRFHNGTEIVHVPSIAVDVVDTT
GAGDTFNGALAVALSEGETLQKAIRFANIAGGLSVTKLGAQGGMPTRDRVREVQVIVG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatattgcagtagtaggaagcatttcaatggacttagtggctgtttcaaaaaaa
cggccgaaagcaggagaaacagtaattggtgaagcgtttcatacaatcccaggagggaaa
ggggcaaaccaagcagttgctgcagctaggttaggagcaaatgtagcaatggttggagcg
gtaggaaatgatgattatggaacagtagttagaaaaaatttagagaacgaacgcattttt
atcgattatgtggtaccggttacagatagaacgacaggaattgctcatatcgttttagca
gaagaagataacagtattgttgtcgtacaaggggcaaatgctcttgtaaataagtcagtt
gtagatcgctccaaagaccttcttgtaaaagcggatatggttgttcttcaactagaaatt
ccacttgaaacagtaaaatatgtattggctatttgtgaggaacataatattcctgttatg
ttgaatccagcgccagcacaagttttatcagaagaaattttagaaaaagcaacttatatt
acgccaaatgaacatgagtgccgcatcgtattagatgattttacatcaccaattgaagat
ttattggcgaagtatccaaataaattattgatgacagaaggttctaacggtgttcgtttc
cataatggaacagagattgtacatgttcctagcattgctgttgatgtagtggatacaact
ggagctggtgatacatttaatggtgcgttagcagttgcactttctgaaggggagacactt
caaaaagcaattcgtttcgcgaatattgccggtggtctttctgtaacgaaacttggggca
cagggcggtatgccaacgagagatcgagtacgtgaagtgcaggtgattgttggatga

DBGET integrated database retrieval system