KEGG   Bacillus cereus ATCC 14579: BC0802Help
Entry
BC0802            CDS       T00127                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BC0802
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC0802
  Lipid metabolism
   00071 Fatty acid degradation
    BC0802
  Amino acid metabolism
   00350 Tyrosine metabolism
    BC0802
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BC0802
   00626 Naphthalene degradation
    BC0802
Enzymes [BR:bce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BC0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
784588..785583
Genome map
AA seq 331 aa AA seqDB search
MNHTSFRAIVVNETENHQFVRKVVEREVSSLPEGDVFIQVHYSSLNYKDALSATGNKGVT
RTYPHTPGIDAAGVVVSSEDATIKAGDQVIVTGYDLGMNTSGGFGEYIRVPSSWVVPLPE
GMSLKESMMYGTAGFTAALSVYKLIGAGVKPSMGDVLVTGATGGVGSVAVSILSKLGFNV
VGATGKMEEEDMLLRLGAKKVIHRAELNDESGSPMLKGIYAGVIDTVGGHMLETALKTVK
YGGCVTTCGNVAGQELQTTVYPFILRGISLLGIDSVQCPVDVRRDVWTLLAKEWGNKELL
SYTEECTLEELEKKFALILQGKLKGRTVVKI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatacatcattccgagcaatcgttgtgaacgaaacggaaaatcatcagtttgta
agaaaagttgttgagagagaagtaagtagtttacctgagggagacgtattcatacaagtt
cattattcttcattaaattataaagatgctctttcagctactggtaataagggtgttacg
agaacatatcctcatacgccaggaattgatgctgcaggagtggttgtgagtagtgaagat
gctaccattaaagcaggagatcaagttattgtaacgggatatgacttaggtatgaatacc
tctggtggtttcggagaatatattcgcgtgccatcatcttgggtcgtgcctttaccggaa
ggaatgtcattaaaggaaagtatgatgtatgggacagcaggttttactgcggctttgtcg
gtatataagcttattggagcaggagtcaagcctagtatgggagatgttttagtaacgggt
gctacaggcggcgtagggagtgtagctgttagtatattaagtaagctagggtttaacgta
gtaggagcgacaggaaaaatggaagaggaagatatgctgctacgtctaggagcgaaaaag
gtgattcatcgcgcggaattgaatgatgaatcaggaagcccgatgttaaaagggatatac
gcgggagttatcgatactgtaggtggacatatgctagaaacagctttaaaaacagtaaag
tatggtggttgtgtaacgacatgcggtaatgtggcaggccaggaactacaaacaacggta
tatccgtttattttacgaggtataagccttttagggatagattccgtgcaatgcccagta
gatgtgagaagagatgtttggacgcttttagcgaaagaatggggaaataaagagttacta
tcttatacagaagaatgtacattagaagaattagagaagaagtttgcacttatattgcaa
ggaaagttaaaaggaaggacagttgttaaaatataa

DBGET integrated database retrieval system