KEGG   Bacillus cereus ATCC 14579: BC1007Help
Entry
BC1007            CDS       T00127                                 

Definition
chemotaxis protein methyltransferase (EC:2.1.1.80)
Orthology
K00575  
chemotaxis protein methyltransferase CheR [EC:2.1.1.80]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bce02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bce02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(987091..987948)
Genome map
AA seq 285 aa AA seqDB search
MENKYYNFDPSVDTDERTNLEIELLLEAVFKLSGFDFRQYARTSIYRRICNRMQLSNIPT
ISKLIEKVIHEEGVLEQLLNDFSINVTEMFRNPAFFKALREHVIPELKKQPEIRIWHAGC
ATGEEVLSMSILLHEEGLSEKSVIYATDMNTNVLEKAKQGILPLNKMQTYTKNYLQAGGT
QAFSNYYSTDNRFAYFNPSLLQNIIFAQHNLVTDQSFNEFHIILCRNVLIYFTSKLQNQV
QQLFYESLGHNGFLCLGNKETLRFSNIMPHYTQFNPSEQIYQKIQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaataagtattataattttgatccatcagtagatacggatgagcgcacaaactta
gaaattgaattactattggaagcggtatttaaactatcaggatttgattttcgccaatat
gctcgcacatctatttatagaaggatttgtaatcgaatgcagctctctaatatcccaacc
atttcaaaattaattgaaaaagtaattcacgaggaaggggttttagaacagttattaaat
gatttctcgattaatgtaactgagatgttccgtaaccctgccttttttaaagcgctaaga
gagcatgttattcctgaattgaaaaagcaacctgaaattagaatttggcatgctggatgc
gcaactggtgaagaagtattatcaatgtccatcttacttcacgaagaaggattaagtgaa
aagtcggttatttacgcaacagatatgaatacaaatgtgttagaaaaagcaaaacaaggt
atcctcccgttaaataaaatgcaaacttatacgaaaaactatttacaagctggcggtaca
caagcgttttctaactattattcaacagataatcgttttgcttattttaatccatcactt
ttacaaaacattatttttgcacagcataatttagtaaccgatcaatcttttaacgagttt
catattatactttgtcgtaacgttttaatttactttacaagcaaacttcaaaatcaagtg
cagcaactattttatgaaagcttaggtcacaatggatttctatgtttaggaaataaagaa
actcttcgtttttcaaatataatgccgcattatacccaatttaatcctagtgaacaaatt
tatcaaaaaatacaataa

DBGET integrated database retrieval system