KEGG   Bacillus cereus ATCC 14579: BC1007Help
Entry
BC1007            CDS       T00127                                 

Definition
chemotaxis protein methyltransferase (EC:2.1.1.80)
Orthology
K00575  
chemotaxis protein methyltransferase CheR [EC:2.1.1.80]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bce00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BC1007
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BC1007
Enzymes [BR:bce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     BC1007
Bacterial motility proteins [BR:bce02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BC1007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(987091..987948)
Genome map
AA seq 285 aa AA seqDB search
MENKYYNFDPSVDTDERTNLEIELLLEAVFKLSGFDFRQYARTSIYRRICNRMQLSNIPT
ISKLIEKVIHEEGVLEQLLNDFSINVTEMFRNPAFFKALREHVIPELKKQPEIRIWHAGC
ATGEEVLSMSILLHEEGLSEKSVIYATDMNTNVLEKAKQGILPLNKMQTYTKNYLQAGGT
QAFSNYYSTDNRFAYFNPSLLQNIIFAQHNLVTDQSFNEFHIILCRNVLIYFTSKLQNQV
QQLFYESLGHNGFLCLGNKETLRFSNIMPHYTQFNPSEQIYQKIQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaataagtattataattttgatccatcagtagatacggatgagcgcacaaactta
gaaattgaattactattggaagcggtatttaaactatcaggatttgattttcgccaatat
gctcgcacatctatttatagaaggatttgtaatcgaatgcagctctctaatatcccaacc
atttcaaaattaattgaaaaagtaattcacgaggaaggggttttagaacagttattaaat
gatttctcgattaatgtaactgagatgttccgtaaccctgccttttttaaagcgctaaga
gagcatgttattcctgaattgaaaaagcaacctgaaattagaatttggcatgctggatgc
gcaactggtgaagaagtattatcaatgtccatcttacttcacgaagaaggattaagtgaa
aagtcggttatttacgcaacagatatgaatacaaatgtgttagaaaaagcaaaacaaggt
atcctcccgttaaataaaatgcaaacttatacgaaaaactatttacaagctggcggtaca
caagcgttttctaactattattcaacagataatcgttttgcttattttaatccatcactt
ttacaaaacattatttttgcacagcataatttagtaaccgatcaatcttttaacgagttt
catattatactttgtcgtaacgttttaatttactttacaagcaaacttcaaaatcaagtg
cagcaactattttatgaaagcttaggtcacaatggatttctatgtttaggaaataaagaa
actcttcgtttttcaaatataatgccgcattatacccaatttaatcctagtgaacaaatt
tatcaaaaaatacaataa

DBGET integrated database retrieval system