KEGG   Bacillus cereus ATCC 14579: BC1070Help
Entry
BC1070            CDS       T00127                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bce00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1054539..1055945
Genome map
AA seq 468 aa AA seqDB search
MIIGGGITGLTAMYNLQKNIHEKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERGPDSFL
ARKESAARLVKELGLGDELVNNQAGQSFILVNNRLHKMPNGSMMGIPTQITPFLFSGLFS
PIGKLRAGFDLLMPRSKPVSDQSLGQFFRHRLGNEVVENLIEPLLSGIYAGDIDEMSLMS
TFPQMYQIEQKHRSISLGMRTLAPKEEKAEPKKGMFQTVKTGLESIVKSLEAKMHEGTII
KGTRIEKVAKQGDGYTITLSNGKEIEADAIVVATSHKVLPSMFAQYKQFRFFRNIPSTSV
ANVALAFQKSAIQRDINGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCYVGRAG
DEAVVEQTEEELVQLVLEDLRKTMDITEDPEFTIVSRWKEAMPQYTVGHNERMKKLTTFM
EKELPGIYLAGSSYAGAGLPDCMNQGEEAAKRVLFHLEKVIDAELIAQ
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtgatcatcggcggaggcatcactggattaacagcaatgtataacttacaaaaaaatatt
catgaaaaaaacttgccgattgatacattacttatagaagcatcgggtaaacttggcgga
aaaattcaaaccgttcgaaaagatggatttacaattgagcgcggaccagattctttctta
gcacgaaaagaaagtgcagctagattagtgaaagaattaggtcttggcgatgaacttgta
aataatcaagccggtcaatcatttatccttgtaaacaatcggttacataaaatgccgaat
ggatcaatgatgggaattccaacgcaaattacgccgtttctattttccgggctgttctcc
ccaattggtaaactaagagctggctttgatttattaatgccgaggtcaaagccagtatct
gaccaatcactcggacaatttttcagacatcgtcttggaaacgaagtggttgaaaactta
atagagccgttactatcgggtatttatgcaggggatattgatgaaatgagcttaatgtca
acattcccgcaaatgtatcaaattgagcagaaacatcgcagtatttcactcggtatgcgt
acgctcgctccgaaagaagagaaagctgaaccgaaaaagggaatgttccaaacagtgaaa
acaggtttagaatctatcgtaaaatctctcgaagcaaagatgcatgaaggtacgataata
aagggaactcgcattgaaaaagttgcgaaacagggtgatggttatacgattactcttagt
aacggaaaagaaatagaagcggacgccatcgtagtggcaacttcgcataaagtattgccg
tccatgtttgctcagtacaagcagtttcgtttcttccgtaatattccatccacatccgtt
gcgaatgtggcacttgctttccaaaagtctgcaatccagcgcgatattaatggtacagga
tttgtcgtatcacgaaatagcgattacaccattacagcatgtacgtggacgcataaaaaa
tggccacatacaacgccagaaggaaaaacactccttcgctgttacgttggacgtgctggt
gatgaagcggttgtagaacaaactgaagaagaactcgttcagctcgtactagaagattta
aggaagacgatggatattacagaggatccagagtttacaatcgtaagtcgctggaaagaa
gcgatgcctcaatatacagtgggccataacgagcgaatgaaaaagctcacaacatttatg
gagaaagagttgccaggtatatacttggcaggtagctcctatgctggtgctggacttcca
gactgtatgaatcaaggtgaggaagctgcaaagcgtgtattatttcatttggagaaagta
atagatgctgaattaatcgcacaataa

DBGET integrated database retrieval system