KEGG   Bacillus cereus ATCC 14579: BC1127Help
Entry
BC1127            CDS       T00127                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1127
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1127
   00630 Glyoxylate and dicarboxylate metabolism
    BC1127
Enzymes [BR:bce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BC1127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1108649..1110211
Genome map
AA seq 520 aa AA seqDB search
MPGEMLPAYNEILTPEVLSFLKELHENFNERRIELLQKRVEKQKRINAGEFPKFLEETKH
IREADWTIAKLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNSPTWENAVEG
QINLRDAVKGTISHKNDKGKEYRLNEKTAVLIVRPRGWHLEEKHMQVDGKNMSGSLVDFG
LYFFHNAKALLAKGSGPYFYLPKMESYLEARLWNDVFVFAQKYIGIPNGTIKATVLLETI
HASFEMDEILYELKDHSAGLNCGRWDYIFSFLKSFRNHNKFLLPDRAQVTMTAPFMRSYS
LKVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHDGTWVAHPGL
VPVAMEVFNHIMKTPNQIFRKREEICVTENDLLEVPVGTITEEGLRMNISVGIQYIASWL
SGRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNITLELMEELKEEELAKIER
EIGKEAFKKGRFQEATTLFTDLVRNDEFVPFLTLPGYEIL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
ttgcccggagaaatgttaccagcgtacaacgaaatattgacacctgaggtgcttagtttt
ttgaaggaactacatgagaattttaatgagcgccgcatagaacttttacaaaaacgtgta
gaaaaacaaaagagaattaatgcaggggagtttccgaagtttctagaagaaacaaaacac
atacgtgaagcggattggacaattgccaagctgccaaaagacttagaggatcgccgcgta
gagattactggaccggtagatagaaagatggtcattaacgctttaaattcaggagcgcat
ctttttatggcggattttgaagattcgaattcaccaacttgggaaaacgcagttgaaggg
caaatcaatttacgagatgcagtaaagggaacgatttcacataaaaatgataaagggaaa
gaatatagattaaatgagaaaacagctgtactcattgtacgtccaagaggatggcattta
gaggaaaagcatatgcaagttgatgggaaaaatatgtcgggtagtttagtagatttcggc
ttgtattttttccataatgcgaaagctcttttagcaaaagggagcggcccatacttttac
ttaccgaaaatggaaagttatttagaagcgagattatggaatgatgtattcgtatttgct
caaaaatatatcggcattccaaatggaacgattaaagcaactgtgttactagaaacgatt
cacgcttcgtttgaaatggatgaaattttatatgagctaaaagatcattctgctggctta
aattgcggaagatgggattatatttttagctttttaaagagtttccgtaatcataataaa
ttcttactaccagatagagcacaagtcacgatgacggcgccatttatgcgttcgtattct
ttgaaagtaattcaaacatgtcaccgccgtaatgcaccagcaattggaggaatggcggca
caaattccgattaaaaataatccagaagcaaatgaagcagcttttgaaaaagtgcgtgct
gataaggaacgcgaagctttagacggtcatgacgggacttgggtcgcccaccctggactt
gtaccggttgcaatggaagtgtttaatcacattatgaaaacaccaaatcaaatttttaga
aaacgtgaagaaatatgtgtaacagaaaacgatttactagaggtaccggtgggaacgatt
acagaagagggccttcgcatgaatattagcgtaggtattcaatatattgcatcttggtta
agcggacggggagcagcacccatttataatttaatggaagatgcggcaacagctgaaatt
tcaagagcacaagtatggcaatggattcgtcatgaaggtggaaaactaaatgatggtcgt
aatattacgcttgaattaatggaagagctaaaagaagaagaattagcaaaaatagaaaga
gagattggtaaggaagcctttaagaaagggagattccaagaggcgacaacgttgtttaca
gatctcgttcgaaatgatgaattcgtaccatttttaacattaccgggttatgaaatttta
taa

DBGET integrated database retrieval system