KEGG   Bacillus cereus ATCC 14579: BC1127Help
Entry
BC1127            CDS       T00127                                 

Definition
(RefSeq) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00620  Pyruvate metabolism
bce00630  Glyoxylate and dicarboxylate metabolism
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01120  Microbial metabolism in diverse environments
bce01200  Carbon metabolism
Module
bce_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1127
   00630 Glyoxylate and dicarboxylate metabolism
    BC1127
Enzymes [BR:bce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BC1127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-GeneID: 1203476
NCBI-ProteinID: NP_830913
UniProt: Q81GR0
Position
1108649..1110211
Genome map
AA seq 520 aa AA seqDB search
MPGEMLPAYNEILTPEVLSFLKELHENFNERRIELLQKRVEKQKRINAGEFPKFLEETKH
IREADWTIAKLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNSPTWENAVEG
QINLRDAVKGTISHKNDKGKEYRLNEKTAVLIVRPRGWHLEEKHMQVDGKNMSGSLVDFG
LYFFHNAKALLAKGSGPYFYLPKMESYLEARLWNDVFVFAQKYIGIPNGTIKATVLLETI
HASFEMDEILYELKDHSAGLNCGRWDYIFSFLKSFRNHNKFLLPDRAQVTMTAPFMRSYS
LKVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHDGTWVAHPGL
VPVAMEVFNHIMKTPNQIFRKREEICVTENDLLEVPVGTITEEGLRMNISVGIQYIASWL
SGRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNITLELMEELKEEELAKIER
EIGKEAFKKGRFQEATTLFTDLVRNDEFVPFLTLPGYEIL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
ttgcccggagaaatgttaccagcgtacaacgaaatattgacacctgaggtgcttagtttt
ttgaaggaactacatgagaattttaatgagcgccgcatagaacttttacaaaaacgtgta
gaaaaacaaaagagaattaatgcaggggagtttccgaagtttctagaagaaacaaaacac
atacgtgaagcggattggacaattgccaagctgccaaaagacttagaggatcgccgcgta
gagattactggaccggtagatagaaagatggtcattaacgctttaaattcaggagcgcat
ctttttatggcggattttgaagattcgaattcaccaacttgggaaaacgcagttgaaggg
caaatcaatttacgagatgcagtaaagggaacgatttcacataaaaatgataaagggaaa
gaatatagattaaatgagaaaacagctgtactcattgtacgtccaagaggatggcattta
gaggaaaagcatatgcaagttgatgggaaaaatatgtcgggtagtttagtagatttcggc
ttgtattttttccataatgcgaaagctcttttagcaaaagggagcggcccatacttttac
ttaccgaaaatggaaagttatttagaagcgagattatggaatgatgtattcgtatttgct
caaaaatatatcggcattccaaatggaacgattaaagcaactgtgttactagaaacgatt
cacgcttcgtttgaaatggatgaaattttatatgagctaaaagatcattctgctggctta
aattgcggaagatgggattatatttttagctttttaaagagtttccgtaatcataataaa
ttcttactaccagatagagcacaagtcacgatgacggcgccatttatgcgttcgtattct
ttgaaagtaattcaaacatgtcaccgccgtaatgcaccagcaattggaggaatggcggca
caaattccgattaaaaataatccagaagcaaatgaagcagcttttgaaaaagtgcgtgct
gataaggaacgcgaagctttagacggtcatgacgggacttgggtcgcccaccctggactt
gtaccggttgcaatggaagtgtttaatcacattatgaaaacaccaaatcaaatttttaga
aaacgtgaagaaatatgtgtaacagaaaacgatttactagaggtaccggtgggaacgatt
acagaagagggccttcgcatgaatattagcgtaggtattcaatatattgcatcttggtta
agcggacggggagcagcacccatttataatttaatggaagatgcggcaacagctgaaatt
tcaagagcacaagtatggcaatggattcgtcatgaaggtggaaaactaaatgatggtcgt
aatattacgcttgaattaatggaagagctaaaagaagaagaattagcaaaaatagaaaga
gagattggtaaggaagcctttaagaaagggagattccaagaggcgacaacgttgtttaca
gatctcgttcgaaatgatgaattcgtaccatttttaacattaccgggttatgaaatttta
taa

DBGET integrated database retrieval system